Comparing 3608266 FitnessBrowser__Dino:3608266 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
8bftA The e. Coli trpd2 protein ybib in complex with a c-terminal peptide from obge (see paper)
26% identity, 72% coverage: 1:234/323 of query aligns to 2:240/321 of 8bftA
1gxbA Anthranilate phosphoribosyltransferase in complex with pyrophosphate and magnesium (see paper)
27% identity, 59% coverage: 42:231/323 of query aligns to 38:223/339 of 1gxbA
3gbrA Anthranilate phosphoribosyl-transferase (trpd) double mutant d83g f149s from s. Solfataricus (see paper)
26% identity, 59% coverage: 42:231/323 of query aligns to 38:224/341 of 3gbrA
2gvqD Anthranilate phosphoribosyl-transferase (trpd) from s. Solfataricus in complex with anthranilate (see paper)
24% identity, 59% coverage: 42:231/323 of query aligns to 38:227/345 of 2gvqD
P50384 Anthranilate phosphoribosyltransferase; EC 2.4.2.18 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 2 papers)
24% identity, 59% coverage: 42:231/323 of query aligns to 38:227/345 of P50384
1zxyA Anthranilate phosphoribosyltransferase from sulfolobus solfataricus in complex with prpp and magnesium (see paper)
26% identity, 59% coverage: 42:231/323 of query aligns to 38:227/344 of 1zxyA
4yi7A Anthranilate bound at active site of anthranilate phosphoribosyl transferase from acinetobacter (anprt; trpd)
24% identity, 74% coverage: 20:258/323 of query aligns to 17:246/331 of 4yi7A
1kgzB Crystal structure analysis of the anthranilate phosphoribosyltransferase from erwinia carotovora (current name, pectobacterium carotovorum) (see paper)
24% identity, 73% coverage: 16:250/323 of query aligns to 11:247/330 of 1kgzB
5nofA Anthranilate phosphoribosyltransferase from thermococcus kodakaraensis (see paper)
28% identity, 62% coverage: 42:241/323 of query aligns to 33:233/325 of 5nofA
>3608266 FitnessBrowser__Dino:3608266
MSLASYIAIVARGPGRARPLTETEARAAMGHVLDGTGAAEAVGALLMTLRLRGETEDEIT
GFAGALRDHMQRWRALDVDLDWPSYSAGRTRGLPWYLLSARLVAQAGYRVMLHGRNGGDA
ALRSYLAAQGVAIAQTPAAATAALDASGLVYIPLEALSRRTTDLLALRAHLGLRSCVNTC
LRVANPAGARVTVQGVFHPPYRALQETACKRLGDTAAMIIKGGGGEFERHPGKAVVCHGH
GPTGAWTDAPALLRDPRRLTEVTDNPAHLTALWNGTWHHPFALATVLGTAALALWSLGAN
QTLADAEAHAARLWATRSSRRAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory