Comparing 3608333 FitnessBrowser__Dino:3608333 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4dz4B X-ray crystal structure of a hypothetical agmatinase from burkholderia thailandensis (see paper)
57% identity, 96% coverage: 11:322/324 of query aligns to 11:321/323 of 4dz4B
P60651 Agmatinase; Agmatine ureohydrolase; AUH; EC 3.5.3.11 from Escherichia coli (strain K12) (see paper)
46% identity, 89% coverage: 30:318/324 of query aligns to 15:304/306 of P60651
7lbaB E. Coli agmatinase (see paper)
47% identity, 88% coverage: 30:315/324 of query aligns to 22:308/310 of 7lbaB
7lolA The structure of agmatinase from e. Coli at 1.8 a displaying urea and agmatine (see paper)
47% identity, 88% coverage: 30:315/324 of query aligns to 5:291/294 of 7lolA
7loxA The structure of agmatinase from e. Coli at 3.2 a displaying guanidine in the active site (see paper)
46% identity, 89% coverage: 30:318/324 of query aligns to 1:284/284 of 7loxA
Q9I3S3 Guanidinobutyrase; EC 3.5.3.7 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
37% identity, 94% coverage: 18:320/324 of query aligns to 7:319/319 of Q9I3S3
3nioA Crystal structure of pseudomonas aeruginosa guanidinobutyrase (see paper)
37% identity, 94% coverage: 18:320/324 of query aligns to 4:316/316 of 3nioA
3niqA Crystal structure of pseudomonas aeruginosa guanidinopropionase (see paper)
40% identity, 93% coverage: 17:317/324 of query aligns to 3:310/315 of 3niqA
3nipB Crystal structure of pseudomonas aeruginosa guanidinopropionase complexed with 1,6-diaminohexane (see paper)
40% identity, 93% coverage: 17:317/324 of query aligns to 4:311/316 of 3nipB
Q9I6K2 Guanidinopropionase; EC 3.5.3.17 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
40% identity, 93% coverage: 17:317/324 of query aligns to 6:313/318 of Q9I6K2
P0DJQ3 Proclavaminate amidinohydrolase; Proclavaminic acid amidino hydrolase; EC 3.5.3.22 from Streptomyces clavuligerus (see paper)
38% identity, 90% coverage: 28:319/324 of query aligns to 12:310/313 of P0DJQ3
1gq6B Proclavaminate amidino hydrolase from streptomyces clavuligerus (see paper)
38% identity, 89% coverage: 28:315/324 of query aligns to 4:298/301 of 1gq6B
3lhlA Crystal structure of a putative agmatinase from clostridium difficile
28% identity, 85% coverage: 47:320/324 of query aligns to 6:276/276 of 3lhlA
7esrA Crystal structure of synechocystis sp pcc6803 guanidinium hydrolase (r32) (see paper)
31% identity, 88% coverage: 28:311/324 of query aligns to 54:351/378 of 7esrA
1wogA Crystal structure of agmatinase reveals structural conservation and inhibition mechanism of the ureohydrolase superfamily (see paper)
32% identity, 88% coverage: 28:312/324 of query aligns to 7:296/303 of 1wogA
Q57757 Agmatinase; EC 3.5.3.11 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
28% identity, 82% coverage: 49:313/324 of query aligns to 24:282/284 of Q57757
G7JFU5 Arginase, mitochondrial; Agmatinase ARGAH; Arginine amidohydrolase; MtARGAH; EC 3.5.3.1; EC 3.5.3.11 from Medicago truncatula (Barrel medic) (Medicago tribuloides) (see paper)
30% identity, 86% coverage: 31:310/324 of query aligns to 36:332/338 of G7JFU5
6vstD Arginase from medicago truncatula in complex with ornithine (see paper)
30% identity, 86% coverage: 31:310/324 of query aligns to 18:314/320 of 6vstD
6vstA Arginase from medicago truncatula in complex with ornithine (see paper)
30% identity, 86% coverage: 31:310/324 of query aligns to 15:311/317 of 6vstA
6vsuE Arginase from arabidopsis thaliana in complex with ornithine (see paper)
28% identity, 86% coverage: 31:310/324 of query aligns to 16:312/318 of 6vsuE
>3608333 FitnessBrowser__Dino:3608333
MALEDAGGEVDGAFTRPDPRGLSYEAAYGGALSFLRRRYTKELSGVDVAVSGVPFDLSVT
NRPGCRLGPRAIREASSLQPFDPPYGWGFDPLSEFTVVDYGDLAFDYGRAAGFPAALEAH
IRTILAAGAAPLTMGGDHYISYPILRALAEVHGPLSLLQFDAHSDTWPDEDRDRLDHGTM
FYKAVKDGLIDPARSVQVGIRTTNDTDLGFHVIDAREVHEAGAAAVAAKVRGILGDHKTY
LTFDIDCLDPGTAPGTGTPVWGGLSAGQAAILLRDLAGITVVGGDVVEVSPPYDPSGATA
VAGAHVMTEILCLWAWTRRKGGQA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory