Comparing 3608380 FitnessBrowser__Dino:3608380 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
2pc6A Crystal structure of putative acetolactate synthase- small subunit from nitrosomonas europaea (see paper)
48% identity, 83% coverage: 29:185/190 of query aligns to 4:158/164 of 2pc6A
P9WKJ3 Putative acetolactate synthase small subunit; Acetohydroxy-acid synthase small subunit; AHAS; ALS; EC 2.2.1.6 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
43% identity, 84% coverage: 27:185/190 of query aligns to 4:160/168 of P9WKJ3
A0QUX7 Acetolactate synthase small subunit; Acetohydroxy-acid synthase small subunit; AHAS; ALS; EC 2.2.1.6 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
43% identity, 83% coverage: 28:185/190 of query aligns to 7:162/170 of A0QUX7
Q9FFF4 Acetolactate synthase small subunit 2, chloroplastic; ALS-interacting protein 3; Acetohydroxy-acid synthase small subunit 2; Protein valine-tolerant 1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
42% identity, 85% coverage: 24:184/190 of query aligns to 72:228/477 of Q9FFF4
Sites not aligning to the query:
6vz8G Arabidopsis thaliana acetohydroxyacid synthase complex with valine bound (see paper)
43% identity, 83% coverage: 28:184/190 of query aligns to 3:157/159 of 6vz8G
Q93YZ7 Acetolactate synthase small subunit 1, chloroplastic; ALS-interacting protein 1; Acetohydroxyacid synthase small subunit 1 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
43% identity, 83% coverage: 28:184/190 of query aligns to 319:473/491 of Q93YZ7
Sites not aligning to the query:
6vz8F Arabidopsis thaliana acetohydroxyacid synthase complex with valine bound (see paper)
40% identity, 82% coverage: 29:184/190 of query aligns to 5:156/159 of 6vz8F
O60086 Probable acetolactate synthase small subunit; Acetohydroxy-acid synthase small subunit; AHAS; ALS from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
34% identity, 83% coverage: 29:185/190 of query aligns to 71:265/289 of O60086
Sites not aligning to the query:
6wo1B Hybrid acetohydroxyacid synthase complex structure with cryptococcus neoformans ahas catalytic subunit and saccharomyces cerevisiae ahas regulatory subunit (see paper)
33% identity, 84% coverage: 26:184/190 of query aligns to 2:195/197 of 6wo1B
6u9dL Saccharomyces cerevisiae acetohydroxyacid synthase (see paper)
31% identity, 84% coverage: 26:184/190 of query aligns to 35:240/255 of 6u9dL
>3608380 FitnessBrowser__Dino:3608380
MSPLKIEQGSSKHSAYDLRSNFGDHQETHTLAVVVDNEAGVLARVIGLFSGRGYNIESLT
VAEIDHEGHRSRITIVTTGTPQVIEQIKAQLARMVPVHEVHDLTVEGASVERELALFKVA
GTGDKRIEALRLAEIFRANVVDSTLQSFVFEITGTPAKIDAFGELMRPLGLTEIARTGVA
ALSRGAALPE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory