Comparing 3608428 FitnessBrowser__Dino:3608428 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
6ioxA Crystal structure of porphyromonas gingivalis phosphotransacetylase in complex with acetyl-coa (see paper)
43% identity, 96% coverage: 4:329/341 of query aligns to 8:333/339 of 6ioxA
2af3C Phosphotransacetylase from methanosarcina thermophila soaked with coenzyme a (see paper)
43% identity, 96% coverage: 4:329/341 of query aligns to 4:326/332 of 2af3C
P38503 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.8 from Methanosarcina thermophila (see 2 papers)
43% identity, 96% coverage: 4:329/341 of query aligns to 5:327/333 of P38503
Sites not aligning to the query:
1xcoD Crystal structure of a phosphotransacetylase from bacillus subtilis in complex with acetylphosphate (see paper)
45% identity, 93% coverage: 12:329/341 of query aligns to 15:323/325 of 1xcoD
Q8ZND6 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.222; EC 2.3.1.8 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
42% identity, 94% coverage: 11:329/341 of query aligns to 399:708/714 of Q8ZND6
Sites not aligning to the query:
6zngF Maeb full-length acetyl-coa bound state (see paper)
32% identity, 93% coverage: 17:333/341 of query aligns to 439:746/753 of 6zngF
Sites not aligning to the query:
P76558 NADP-dependent malic enzyme; NADP-ME; EC 1.1.1.40 from Escherichia coli (strain K12) (see paper)
32% identity, 97% coverage: 1:331/341 of query aligns to 431:755/759 of P76558
Sites not aligning to the query:
3u9eB The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with coa.
28% identity, 45% coverage: 169:320/341 of query aligns to 129:276/288 of 3u9eB
Sites not aligning to the query:
3uf6A The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with cod (3'-dephosphocoenzyme a)
28% identity, 45% coverage: 169:320/341 of query aligns to 127:274/285 of 3uf6A
Sites not aligning to the query:
>3608428 FitnessBrowser__Dino:3608428
MKPLQMILANAARSDRKIALSEGEDPRVVAAAVQARKQRVARVVLVGDRATIVARLAEAG
GAELDGIDVHDPREDLHRAEMAATYHQLRKHKGVTEADAEAAILNPHVYAALLVRLGHAD
GTLGGATATTAEIVRTAIQVIGTAPGAKMVSSFFLMLLCKDHHEKKGGLVFADAGLVIDP
TAAEMAEIGRASAASLVQLTGETPRVAMLSFSTRGSASGDKVSKVVEATEIFRQLAPEVT
VDGELQFDAAFVPEVATAKAPDSAIGGSANVFVFPNLDTGNIAYKIAQRIGGAVAIGPIL
QGLALPANDLSRGCSAEDVLHMIATTAAQCQDVAPHHAAAR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory