Comparing 3608476 Dshi_1872 hypothetical protein (RefSeq) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
2ismB Crystal structure of the putative oxidoreductase (glucose dehydrogenase) (ttha0570) from thermus theromophilus hb8
36% identity, 61% coverage: 31:286/422 of query aligns to 2:236/333 of 2ismB
3a9hA Crystal structure of pqq-dependent sugar dehydrogenase holo-form (see paper)
34% identity, 60% coverage: 36:287/422 of query aligns to 9:234/338 of 3a9hA
Sites not aligning to the query:
3a9gA Crystal structure of pqq-dependent sugar dehydrogenase apo-form (see paper)
34% identity, 60% coverage: 36:287/422 of query aligns to 9:234/338 of 3a9gA
P75804 Aldose sugar dehydrogenase YliI; Asd; Soluble aldose sugar dehydrogenase YliI; EC 1.1.5.- from Escherichia coli (strain K12) (see paper)
26% identity, 100% coverage: 1:422/422 of query aligns to 1:369/371 of P75804
2g8sA Crystal structure of the soluble aldose sugar dehydrogenase (asd) from escherichia coli in the apo-form (see paper)
26% identity, 93% coverage: 30:422/422 of query aligns to 2:347/348 of 2g8sA
7cdyA Crystal structure of glucose dehydrogenase
28% identity, 89% coverage: 38:414/422 of query aligns to 8:335/346 of 7cdyA
P13650 Quinoprotein glucose dehydrogenase B; Glucose dehydrogenase B [pyrroloquinoline-quinone]; Soluble glucose dehydrogenase; s-GDH; EC 1.1.5.2 from Acinetobacter calcoaceticus (see paper)
29% identity, 66% coverage: 4:281/422 of query aligns to 12:294/478 of P13650
Sites not aligning to the query:
1cq1A Soluble quinoprotein glucose dehydrogenase from acinetobacter calcoaceticus in complex with pqqh2 and glucose (see paper)
29% identity, 62% coverage: 19:281/422 of query aligns to 4:264/444 of 1cq1A
Sites not aligning to the query:
1c9uA Crystal structure of the soluble quinoprotein glucose dehydrogenase in complex with pqq (see paper)
29% identity, 62% coverage: 19:281/422 of query aligns to 4:264/444 of 1c9uA
Sites not aligning to the query:
5minB Apo form of the soluble pqq-dependent glucose dehydrogenase from acinetobacter calcoaceticus
29% identity, 62% coverage: 19:281/422 of query aligns to 4:270/453 of 5minB
Sites not aligning to the query:
1cruA Soluble quinoprotein glucose dehydrogenase from acinetobacter calcoaceticus in complex with pqq and methylhydrazine (see paper)
31% identity, 62% coverage: 19:281/422 of query aligns to 4:268/448 of 1cruA
Sites not aligning to the query:
7cgzA Glucose dehydrogenase
26% identity, 89% coverage: 38:414/422 of query aligns to 8:310/321 of 7cgzA
3dasA Structure of the pqq-bound form of aldose sugar dehydrogenase (adh) from streptomyces coelicolor
29% identity, 59% coverage: 36:283/422 of query aligns to 14:233/334 of 3dasA
Sites not aligning to the query:
>3608476 Dshi_1872 hypothetical protein (RefSeq)
MTRLSALSLGAALASATALAAPAFAANTTSLSHEIVLEGLENPWDVAFLEDGTMFFTEKC
LGLSVRLPDGSVNKLLGMKGTDDDYASTAEDLFCEGQAGMQGVAVDPDFAENRQIYVYST
SDLTAPGSNRLLRMTVGEDLASVADRTDIVEDVPYKPAATDHPFGGPGAHNGGRVRFGPD
GFIYLTTGDTHNGEGPQSPTLLAGKVLRIDRDGNAAEGNAPPEGFDPRIYTYGHRNTQGI
TFHPETGAAITAEHGPWHSDEITVLQNGGNAGWDPRPNVGGRGECPDGYCGYSPNQMEGM
DRYERAAFMPMTDLATYPDAMQPIWDNNGWSQGTSSAEFLTGDQWGDWENHLVVGIMGIG
FGGTPIGQRIDVIELNEAGTEVVDVTEMTLPMEPGRFRSLVQGPDGALYAVVDQGMIHKM
MP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory