SitesBLAST
Comparing 3608541 FitnessBrowser__Dino:3608541 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2q7vA Crystal structure of deinococcus radiodurans thioredoxin reductase (see paper)
36% identity, 56% coverage: 224:526/539 of query aligns to 6:300/313 of 2q7vA
- active site: P41 (≠ I259), I45 (≠ A263), E50 (≠ R268), C141 (≠ A358), C144 (≠ V362), D145 (≠ E363)
- binding flavin-adenine dinucleotide: G16 (= G234), P17 (= P235), A18 (= A236), E37 (= E255), K38 (≠ D256), G43 (= G261), Q44 (= Q262), I45 (≠ A263), N53 (= N271), E85 (vs. gap), V86 (vs. gap), T118 (= T335), G119 (= G336), C144 (≠ V362), G282 (= G508), D283 (= D509), Q291 (≠ R517), L292 (≠ V518), S295 (≠ G521)
8ccmA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with compound 2-06
36% identity, 56% coverage: 225:525/539 of query aligns to 2:291/305 of 8ccmA
- binding flavin-adenine dinucleotide: I8 (≠ V231), G9 (= G232), S10 (≠ G233), G11 (= G234), P12 (= P235), A13 (= A236), E32 (= E255), G33 (≠ D256), Q35 (≠ T258), G38 (= G261), A39 (≠ Q262), L40 (≠ A263), T43 (≠ S266), N48 (= N271), D80 (≠ H307), V81 (= V308), M109 (≠ T335), G110 (= G336), T131 (≠ Y357), C135 (≠ V362), G274 (= G508), D275 (= D509), R282 (≠ K516), Q283 (≠ R517), A284 (≠ V518), A287 (≠ G521)
- binding ~{N}6-(4-aminophenyl)-1,2-benzothiazole-3,6-diamine: R114 (= R340), H115 (≠ K341), L116 (= L342), R173 (= R400), E200 (≠ Q429), I201 (≠ V430), I235 (≠ V464)
8cclA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with fragment f2x-entry a09
36% identity, 56% coverage: 225:525/539 of query aligns to 2:291/305 of 8cclA
- binding flavin-adenine dinucleotide: I8 (≠ V231), G9 (= G232), S10 (≠ G233), G11 (= G234), P12 (= P235), A13 (= A236), E32 (= E255), G33 (≠ D256), Q35 (≠ T258), G38 (= G261), A39 (≠ Q262), L40 (≠ A263), T43 (≠ S266), N48 (= N271), D80 (≠ H307), V81 (= V308), M109 (≠ T335), G110 (= G336), T131 (≠ Y357), C135 (≠ V362), G274 (= G508), D275 (= D509), R282 (≠ K516), Q283 (≠ R517), A284 (≠ V518), A287 (≠ G521)
- binding [1,2]thiazolo[5,4-b]pyridin-3-amine: L116 (= L342), R173 (= R400), E200 (≠ Q429), I201 (≠ V430)
8cckA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with fragment f2x-entry h07
36% identity, 56% coverage: 225:525/539 of query aligns to 2:291/305 of 8cckA
- binding flavin-adenine dinucleotide: G9 (= G232), S10 (≠ G233), G11 (= G234), P12 (= P235), A13 (= A236), E32 (= E255), G33 (≠ D256), Q35 (≠ T258), G38 (= G261), A39 (≠ Q262), L40 (≠ A263), T43 (≠ S266), N48 (= N271), D80 (≠ H307), V81 (= V308), M109 (≠ T335), G110 (= G336), T131 (≠ Y357), C135 (≠ V362), G274 (= G508), D275 (= D509), R282 (≠ K516), Q283 (≠ R517), A284 (≠ V518), A287 (≠ G521)
- binding ~{N}-(4-hydroxyphenyl)-2-pyrazol-1-yl-ethanamide: R114 (= R340), H115 (≠ K341), L116 (= L342), V148 (≠ I375), R173 (= R400), E200 (≠ Q429), I201 (≠ V430)
8ccjA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with NADPH
36% identity, 56% coverage: 225:525/539 of query aligns to 2:291/305 of 8ccjA
- binding flavin-adenine dinucleotide: I8 (≠ V231), G9 (= G232), S10 (≠ G233), G11 (= G234), P12 (= P235), A13 (= A236), E32 (= E255), G33 (≠ D256), Q35 (≠ T258), G38 (= G261), A39 (≠ Q262), L40 (≠ A263), T43 (≠ S266), N48 (= N271), D80 (≠ H307), V81 (= V308), M109 (≠ T335), G110 (= G336), T131 (≠ Y357), C135 (≠ V362), G274 (= G508), D275 (= D509), R282 (≠ K516), Q283 (≠ R517), A284 (≠ V518), A287 (≠ G521)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G150 (= G377), G151 (= G378), D152 (≠ N379), S153 (= S380), E156 (≠ Q383), H172 (≠ I399), R173 (= R400), R174 (≠ G401), R178 (≠ A405), I235 (≠ V464)
5uthA Crystal structure of thioredoxin reductase from mycobacterium smegmatis in complex with fad
36% identity, 56% coverage: 225:525/539 of query aligns to 3:292/306 of 5uthA
- active site: C133 (≠ A358), C136 (≠ V362), D137 (≠ E363)
- binding flavin-adenine dinucleotide: I9 (≠ V231), G10 (= G232), S11 (≠ G233), G12 (= G234), P13 (= P235), A14 (= A236), F32 (≠ V254), E33 (= E255), G34 (≠ D256), Q36 (≠ T258), G39 (= G261), A40 (≠ Q262), L41 (≠ A263), N49 (= N271), D81 (≠ H307), V82 (= V308), M110 (≠ T335), G111 (= G336), C136 (≠ V362), G275 (= G508), D276 (= D509), R283 (≠ K516), Q284 (≠ R517), A285 (≠ V518), A288 (≠ G521)
Q70G58 Thioredoxin reductase NTRC; NADPH-dependent thioredoxin reductase C; OsNTRC; EC 1.8.1.9 from Oryza sativa subsp. japonica (Rice) (see 2 papers)
31% identity, 56% coverage: 225:527/539 of query aligns to 69:368/515 of Q70G58
- C203 (≠ A358) mutation to S: Loss of thioredoxin reductase activity.
- C206 (≠ T360) mutation to S: Loss of thioredoxin reductase activity.
- A227 (= A381) mutation to G: Reduces activity 30-fold; when associated with E-245 and F-246.
- V245 (≠ I399) mutation to E: Reduces activity 30-fold; when associated with G-227 and F-246.
- R246 (= R400) mutation to F: Reduces activity 30-fold; when associated with G-227 and E-245.
Sites not aligning to the query:
- 440 C→S: Loss of thioredoxin activity.
- 443 C→S: Loss of thioredoxin activity.
7p9eB Chlamydomonas reinhardtii NADPH dependent thioredoxin reductase 1 domain cs mutant (see paper)
32% identity, 56% coverage: 227:527/539 of query aligns to 3:295/316 of 7p9eB
- binding flavin-adenine dinucleotide: G8 (= G232), S9 (≠ G233), G10 (= G234), P11 (= P235), A12 (= A236), E31 (= E255), G32 (≠ D256), N35 (≠ I259), G36 (= G260), G39 (= G261), Q40 (= Q262), L41 (≠ A263), T44 (≠ S266), N49 (= N271), D81 (≠ A305), V82 (= V306), A109 (= A334), T110 (= T335), W126 (≠ E351), S136 (≠ T360), G276 (= G508), D277 (= D509), R284 (≠ K516), Q285 (≠ R517), A286 (≠ V518), A289 (≠ G521)
7jypA Structure of thioredoxin reductase from the thermophilic eubacterium thermosipho africanus tcf52b
31% identity, 58% coverage: 221:530/539 of query aligns to 1:298/305 of 7jypA
- binding flavin-adenine dinucleotide: G12 (= G232), G14 (= G234), P15 (= P235), A16 (= A236), F34 (≠ V254), E35 (= E255), K36 (≠ D256), G41 (= G261), A42 (≠ Q262), V83 (≠ A305), T112 (= T335), G113 (= G336), G276 (= G508), D277 (= D509)
- binding nicotinamide-adenine-dinucleotide: G153 (= G377), G154 (= G378), S156 (= S380), Q175 (≠ I399), N176 (≠ R400), T181 (≠ A405), V238 (= V464)
P9WHH1 Thioredoxin reductase; TR; TRXR; EC 1.8.1.9 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
34% identity, 58% coverage: 225:535/539 of query aligns to 14:318/335 of P9WHH1
- SGPA 22:25 (≠ GGPA 233:236) binding
- Y32 (= Y243) modified: Phosphotyrosine; by PtkA; mutation to A: Significantly reduces phosphorylation.
- 44:51 (vs. 255:262, 38% identical) binding
- N60 (= N271) binding
- V93 (= V301) binding
- C145 (≠ A358) modified: Disulfide link with 148, Redox-active
- C148 (≠ V362) modified: Disulfide link with 145, Redox-active
- S166 (= S380) binding
- H185 (≠ I399) binding
- R191 (≠ A405) binding
- I248 (≠ V464) binding
- Y268 (≠ F484) binding
- D288 (= D509) binding
- R295 (≠ K516) binding
- RQAV 295:298 (≠ KRVA 516:519) binding
2a87A Crystal structure of m. Tuberculosis thioredoxin reductase (see paper)
35% identity, 56% coverage: 225:525/539 of query aligns to 5:295/313 of 2a87A
- active site: F39 (≠ I259), L43 (≠ A263), D48 (≠ R268), C136 (≠ A358), C139 (≠ V362), D140 (≠ E363)
- binding flavin-adenine dinucleotide: G12 (= G232), S13 (≠ G233), G14 (= G234), P15 (= P235), A16 (= A236), F34 (≠ V254), E35 (= E255), G36 (≠ D256), G40 (= G260), G41 (= G261), A42 (≠ Q262), L43 (≠ A263), T46 (≠ S266), V49 (≠ I269), N51 (= N271), D83 (vs. gap), V84 (= V301), M113 (≠ T335), C139 (≠ V362), G278 (= G508), D279 (= D509), R286 (≠ K516), Q287 (≠ R517), A288 (≠ V518), V289 (≠ A519)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L120 (= L342), G155 (= G378), D156 (≠ N379), S157 (= S380), H176 (≠ I399), R177 (= R400), R178 (≠ G401), R182 (≠ A405), I239 (≠ V464), Y259 (≠ F484), R283 (≠ G513), R286 (≠ K516)
7aawA Thioredoxin reductase from bacillus cereus (see paper)
31% identity, 58% coverage: 223:536/539 of query aligns to 4:305/315 of 7aawA
- binding flavin-adenine dinucleotide: G13 (= G232), G15 (= G234), P16 (= P235), A17 (= A236), E36 (= E255), R37 (≠ D256), G42 (= G261), Q43 (= Q262), T47 (≠ S266), N52 (= N271), G82 (≠ P302), V84 (= V308), A111 (= A334), S112 (≠ T335), G113 (= G336), C138 (≠ V362), G277 (= G508), D278 (= D509), Q286 (≠ R517), I287 (≠ V518)
- binding alpha-D-glucopyranose: R27 (≠ A246), D49 (≠ R268), K74 (= K294), F75 (= F295), P122 (= P345), G123 (≠ R346), E126 (= E349), G129 (= G352), G131 (= G354), V132 (= V355), F143 (≠ C367), E206 (≠ R426), N208 (≠ T428)
7aawB Thioredoxin reductase from bacillus cereus (see paper)
31% identity, 58% coverage: 223:536/539 of query aligns to 1:302/311 of 7aawB
- binding flavin-adenine dinucleotide: G10 (= G232), G12 (= G234), P13 (= P235), A14 (= A236), E33 (= E255), R34 (≠ D256), G39 (= G261), Q40 (= Q262), T44 (≠ S266), N49 (= N271), G79 (≠ P302), D80 (≠ H307), V81 (= V308), S109 (≠ T335), G110 (= G336), Y113 (= Y339), C135 (≠ V362), G274 (= G508), D275 (= D509), Q283 (≠ R517), I284 (≠ V518)
- binding alpha-D-glucopyranose: D46 (≠ R268), E48 (= E270), G126 (= G352), G128 (= G354), D136 (≠ E363), A138 (≠ R365), F139 (≠ Y366), F139 (≠ Y366), F140 (≠ C367)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G150 (= G377), G151 (= G378), D152 (≠ N379), S153 (= S380), E156 (≠ Q383), H172 (≠ I399), R173 (= R400), R174 (≠ G401), R178 (≠ A405), I236 (≠ V464)
5uwyA The crystal structure of thioredoxin reductase from streptococcus pyogenes mgas5005
30% identity, 59% coverage: 222:538/539 of query aligns to 1:305/306 of 5uwyA
- binding flavin-adenine dinucleotide: G13 (= G234), P14 (= P235), A15 (= A236), E34 (= E255), Q35 (≠ D256), G40 (= G261), Q41 (= Q262), T45 (≠ S266), N50 (= N271), V82 (≠ P302), T110 (= T335), G111 (= G336), Y114 (= Y339), C136 (≠ V362), V242 (≠ N469), G275 (= G508), D276 (= D509), Q284 (≠ R517), I285 (≠ V518)
4gcmB Crystal structure of a thioredoxine reductase (trxb) from staphylococcus aureus subsp. Aureus mu50 at 1.80 a resolution
31% identity, 58% coverage: 226:536/539 of query aligns to 5:303/309 of 4gcmB
- active site: C133 (≠ A358), C136 (≠ V362), D137 (≠ E363)
- binding flavin-adenine dinucleotide: G11 (= G232), G13 (= G234), P14 (= P235), A15 (= A236), E34 (= E255), R35 (≠ D256), G40 (= G261), Q41 (= Q262), T45 (≠ S266), N50 (= N271), D81 (≠ V306), I82 (≠ H307), T110 (= T335), G111 (= G336), C136 (≠ V362), G275 (= G508), D276 (= D509), Q284 (≠ R517), I285 (≠ V518)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I117 (≠ L342), G151 (= G377), G152 (= G378), D153 (≠ N379), S154 (= S380), E157 (≠ Q383), R174 (= R400), R175 (≠ G401), R179 (≠ A405), Q181 (≠ S409), I237 (≠ V464)
5mh4A Crystal structure of lactococcus lactis thioredoxin reductase (fr conformation) (see paper)
30% identity, 58% coverage: 226:536/539 of query aligns to 2:300/303 of 5mh4A
- active site: V34 (≠ T258), P35 (≠ I259), M39 (≠ A263), E44 (≠ R268), C130 (≠ A358), C133 (≠ V362), D134 (≠ E363)
- binding flavin-adenine dinucleotide: G10 (= G234), P11 (= P235), A12 (= A236), E31 (= E255), R32 (≠ D256), G37 (= G261), Q38 (= Q262), T42 (≠ S266), N47 (= N271), G77 (= G315), V79 (≠ C317), T107 (= T335), G108 (= G336), E155 (≠ A384), V239 (≠ N469), F242 (≠ W472), G272 (= G508), D273 (= D509), Q281 (≠ R517), I282 (≠ V518)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I146 (= I375), G147 (= G376), G148 (= G377), G149 (= G378), D150 (≠ N379), S151 (= S380), E154 (≠ Q383), H170 (≠ I399), R171 (= R400), R172 (≠ G401), R176 (≠ A405), V234 (= V464), G235 (= G465), R280 (≠ K516), Q281 (≠ R517)
1f6mA Crystal structure of a complex between thioredoxin reductase, thioredoxin, and the NADP+ analog, aadp+ (see paper)
33% identity, 56% coverage: 228:527/539 of query aligns to 8:304/320 of 1f6mA
- active site: S135 (≠ A358), C138 (≠ V362), D139 (≠ E363)
- binding 3-aminopyridine-adenine dinucleotide phosphate: L119 (= L342), G153 (= G377), G154 (= G378), N155 (= N379), T156 (≠ S380), E159 (≠ Q383), H175 (≠ I399), R176 (= R400), R177 (≠ G401), R181 (≠ A405), I243 (≠ V464), G244 (= G465), H245 (≠ A466), R293 (≠ K516), Q294 (≠ R517)
- binding flavin-adenine dinucleotide: G12 (= G232), S13 (≠ G233), G14 (= G234), P15 (= P235), A16 (= A236), T35 (≠ E255), G36 (≠ D256), E38 (≠ T258), G41 (= G261), Q42 (= Q262), L43 (≠ A263), T46 (≠ S266), V49 (≠ I269), N51 (= N271), H83 (≠ R303), I84 (≠ V306), A111 (= A334), T112 (= T335), G113 (= G336), H245 (≠ A466), G285 (= G508), D286 (= D509), R293 (≠ K516), Q294 (≠ R517), A295 (≠ V518), S298 (≠ G521)
P0A9P4 Thioredoxin reductase; TRXR; EC 1.8.1.9 from Escherichia coli (strain K12) (see 2 papers)
33% identity, 56% coverage: 228:527/539 of query aligns to 9:305/321 of P0A9P4
- 36:43 (vs. 255:262, 38% identical) binding
- C136 (≠ A358) modified: Disulfide link with 139, Redox-active
- C139 (≠ V362) modified: Disulfide link with 136, Redox-active
- 287:296 (vs. 509:518, 20% identical) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1tdfA Crystal structure of escherichia coli thioredoxin reductase refined at 2 angstrom resolution: implications for a large conformational change during catalysis (see paper)
33% identity, 56% coverage: 228:527/539 of query aligns to 8:304/316 of 1tdfA
- active site: C135 (≠ A358), S138 (≠ D361), D139 (≠ E363)
- binding flavin-adenine dinucleotide: G12 (= G232), S13 (≠ G233), G14 (= G234), P15 (= P235), A16 (= A236), T35 (≠ E255), G36 (≠ D256), E38 (≠ T258), G41 (= G261), Q42 (= Q262), L43 (≠ A263), T46 (≠ S266), V49 (≠ I269), N51 (= N271), H83 (≠ R303), I84 (≠ V306), A111 (= A334), T112 (= T335), S138 (≠ D361), G285 (= G508), D286 (= D509), R293 (≠ K516), Q294 (≠ R517), A295 (≠ V518), S298 (≠ G521)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L119 (= L342), I151 (= I375), T156 (≠ S380), E159 (≠ Q383), H175 (≠ I399), R176 (= R400), R181 (≠ A405), E183 (≠ S407), I243 (≠ V464), G244 (= G465), H290 (≠ G513), R293 (≠ K516)
6bpyA Aspergillus fumigatus thioredoxin reductase (see paper)
31% identity, 56% coverage: 228:527/539 of query aligns to 5:310/324 of 6bpyA
- binding flavin-adenine dinucleotide: I8 (≠ V231), G9 (= G232), S10 (≠ G233), G11 (= G234), P12 (= P235), A13 (= A236), Y31 (≠ V254), E32 (= E255), G33 (vs. gap), A36 (vs. gap), T38 (≠ L257), A39 (≠ T258), G42 (= G261), Q43 (= Q262), L44 (≠ A263), T47 (≠ S266), I50 (= I269), N52 (= N271), T84 (≠ A300), I85 (≠ V301), T120 (= T335), G121 (= G336), C146 (≠ T360), G291 (= G508), D292 (= D509), R299 (≠ K516), Q300 (≠ R517), A301 (≠ V518), S304 (≠ G521)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G163 (= G377), G164 (= G378), S166 (= S380), R186 (= R400), R187 (≠ G401), R191 (≠ A405), V252 (= V464)
Query Sequence
>3608541 FitnessBrowser__Dino:3608541
MDTLAPDLRTMVRTPLTEAHVAAMRRIGVERAYAAGAAVTALGAAQDRFQYVLEGELEAV
DPVTGGRYGGASLGPGQFVGEISFLNDGKVMLASRACTDSVLLEVPRDAMLRLMADVPEM
SDIIVTVFAARRRRLLESQQAALTLLGADRDRQIRQIAAFASRNRIPYRSLDLDDHEAED
IAQACALLPRHPAVIFGTDTVVEDPSPRKIARLLGIDMALGADHVFDVLIVGGGPAGIAA
AVYAGAEGLSALVVEDLTIGGQAGTSSRIENYMGFPTGISGADLCWRGEVQAMKFGTRFA
VPRRAVHVAPLAAGGFCVTLDDGEEVRTRAIVIATGVQYRKLPIPRLEEFEGAGVYYAAT
DVEARYCRNTDVVVIGGGNSAGQAAMFLSRSARHVHVLIRGDGLAASMSSYLSERLDRDP
AITLHRRTQVTGLHGTDRLEEATIRDGVMGQDWTLRTGAVFVMVGAAPNTGWLDGLVTLD
DKGFVHTGPEVGGRSTYETSCPGIFAVGDVRAGSVKRVASGVGEGSVVISKVWEHVNAP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory