SitesBLAST
Comparing 3608553 FitnessBrowser__Dino:3608553 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
34% identity, 95% coverage: 10:498/514 of query aligns to 4:487/501 of P04983
- K43 (= K49) mutation to R: Loss of transport.
6xjiC Pmtcd abc exporter at c1 symmetry (see paper)
29% identity, 43% coverage: 11:232/514 of query aligns to 1:206/290 of 6xjiC
- binding phosphothiophosphoric acid-adenylate ester: Y10 (≠ F20), V15 (≠ A25), N35 (= N45), G36 (= G46), G38 (= G48), K39 (= K49), T40 (= T50), T41 (= T51), K115 (≠ A142), K119 (≠ T146), S121 (= S148)
- binding magnesium ion: T40 (= T50), E70 (≠ Q92)
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
32% identity, 47% coverage: 11:250/514 of query aligns to 4:237/369 of P19566
- L86 (= L96) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P173) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (≠ T178) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
Sites not aligning to the query:
- 306 E→K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
26% identity, 45% coverage: 10:240/514 of query aligns to 4:244/254 of 1g6hA
6xjhC Pmtcd abc exporter without the basket domain at c2 symmetry (see paper)
29% identity, 42% coverage: 11:228/514 of query aligns to 1:202/219 of 6xjhC
- binding phosphothiophosphoric acid-adenylate ester: Y10 (≠ F20), V15 (≠ A25), N35 (= N45), G36 (= G46), G38 (= G48), K39 (= K49), T40 (= T50), T41 (= T51), K115 (≠ A142), K119 (≠ T146), S121 (= S148)
- binding magnesium ion: T40 (= T50), E70 (≠ Q92)
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
33% identity, 42% coverage: 9:225/514 of query aligns to 3:222/648 of P75831
- K47 (= K49) mutation to L: Lack of activity.
- D169 (= D171) mutation to N: Lack of activity.
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
26% identity, 45% coverage: 10:240/514 of query aligns to 4:244/253 of 1g9xB
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
30% identity, 42% coverage: 9:225/514 of query aligns to 1:215/241 of 4u00A
E9Q876 Glucosylceramide transporter ABCA12; ATP-binding cassette sub-family A member 12; EC 7.6.2.1 from Mus musculus (Mouse) (see 2 papers)
31% identity, 41% coverage: 13:222/514 of query aligns to 1348:1553/2595 of E9Q876
- 1388:1461 (vs. 53:125, 26% identical) mutation to M: In a mouse model for harlequin ichthyosis (HI), smooth skin (smsk) mutant mice show a pronounced perinatal lethal skin phenotype in 25% of the offspring and newborn mutant pups die within a few hours after birth, and appear severely dehydrated with dry cracking skin. Smsk homozygous mutants embryos show a normal appearance at 14.5 dpc, but at 16.5 dpc develop a partial absence of normal skin folds around the trunk and limbs, and by 18.5 dpc develop a taut, thick skin and limb contractures.
Sites not aligning to the query:
- 1996 G→D: In a mouse model for harlequin ichthyosis (HI), homozygous mice are embryonic lethal but occasionally pups are found in the first few hours after birth but die and are severely dehydrated and fail to suckle normally. Homozygous pups show hallmarks of HI desease including hyperkeratosis, abnormal extracellular lipid lamellae and defects in cornified envelope processing. At 14.5 dpc and 15.5 dpc homozygous embryos appear normal; however from 16.5 dpc onwards they are characterized by an absence of normal skin folds around the trunk and limbs. As development progressed, embryos develop a taut, thick epidermis and multiple contractures affecting the limbs. Late stage embryos are smaller.
3c4jA Abc protein artp in complex with atp-gamma-s
29% identity, 41% coverage: 15:225/514 of query aligns to 8:217/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
29% identity, 41% coverage: 15:225/514 of query aligns to 8:217/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
29% identity, 41% coverage: 15:225/514 of query aligns to 8:217/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
29% identity, 41% coverage: 15:225/514 of query aligns to 8:217/242 of 2oljA
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
31% identity, 49% coverage: 4:257/514 of query aligns to 5:260/265 of P07821
- K50 (= K49) mutation to Q: Lack of activity.
- D172 (= D171) mutation to E: Lack of activity.
- E173 (= E172) mutation to A: Lack of activity.
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
31% identity, 47% coverage: 11:250/514 of query aligns to 3:236/374 of 2awnB
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
31% identity, 47% coverage: 11:250/514 of query aligns to 3:236/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ F20), S37 (≠ N45), G38 (= G46), C39 (≠ A47), G40 (= G48), K41 (= K49), S42 (≠ T50), T43 (= T51), Q81 (= Q92), R128 (≠ A142), A132 (≠ T146), S134 (= S148), G136 (= G150), Q137 (≠ E151), E158 (= E172), H191 (= H204)
- binding magnesium ion: S42 (≠ T50), Q81 (= Q92)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
31% identity, 47% coverage: 11:250/514 of query aligns to 3:236/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ F20), G38 (= G46), C39 (≠ A47), G40 (= G48), K41 (= K49), S42 (≠ T50), T43 (= T51), R128 (≠ A142), S134 (= S148), Q137 (≠ E151)
- binding beryllium trifluoride ion: S37 (≠ N45), G38 (= G46), K41 (= K49), Q81 (= Q92), S134 (= S148), G136 (= G150), H191 (= H204)
- binding magnesium ion: S42 (≠ T50), Q81 (= Q92)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
31% identity, 47% coverage: 11:250/514 of query aligns to 3:236/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ F20), V17 (≠ A25), G38 (= G46), C39 (≠ A47), G40 (= G48), K41 (= K49), S42 (≠ T50), T43 (= T51), R128 (≠ A142), A132 (≠ T146), S134 (= S148), Q137 (≠ E151)
- binding tetrafluoroaluminate ion: S37 (≠ N45), G38 (= G46), K41 (= K49), Q81 (= Q92), S134 (= S148), G135 (≠ V149), G136 (= G150), E158 (= E172), H191 (= H204)
- binding magnesium ion: S42 (≠ T50), Q81 (= Q92)
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
31% identity, 47% coverage: 11:250/514 of query aligns to 3:236/371 of 3puvA
- binding adenosine-5'-diphosphate: W12 (≠ F20), V17 (≠ A25), G38 (= G46), C39 (≠ A47), G40 (= G48), K41 (= K49), S42 (≠ T50), T43 (= T51), R128 (≠ A142), A132 (≠ T146), S134 (= S148), Q137 (≠ E151)
- binding magnesium ion: S42 (≠ T50), Q81 (= Q92)
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
31% identity, 47% coverage: 11:250/514 of query aligns to 4:237/371 of P68187
- A85 (≠ T95) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ G119) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (≠ L127) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ L130) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (= E132) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ Q137) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G150) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D171) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
- R228 (≠ M241) mutation to C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
Sites not aligning to the query:
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
Query Sequence
>3608553 FitnessBrowser__Dino:3608553
MTETNGARPVLRLDQITKRFGALTANDAISFDLHAGEVVALLGENGAGKTTLMNILFGHY
TADEGTVEVFGQTLPPGVPRAALAAGVGMVHQHFTLADNLSVLDNVILGTVPLWRAGLGS
GAARRKLRALAEDFGLQVDPEARVGTLSVGERQRVEILKALYRDARILILDEPTAVLTPQ
EAEALFATLRRAVARGMSVIFISHKLHEVMSVAHRVVVLRHGRVVGRVATDETDRHALAE
MMVGAEITAPAPRPATPGAALMTLDRVCTDARGTATGLRDVSLTLRAGQITGLAGVSGNG
QAALADLIGGLIAPVAGALRLGNAEVADWSPRAALAQGIGRIPEDRHKTGTIADFTLTEN
AILEAYPKAQFSRSGWMRWGAAESFARDVIASYDVRCPGPETPIRLLSGGNMQKLILGRV
LEDGPRIVLANQPVRGLDIGAVTYVQEQLIAARDGGAAVLLISEDLDEVLALSDVIHVMS
EGRLSPEFARGSMTPAQLGVWMAGDGFAEDPHAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory