Comparing 3608586 Dshi_1980 ABC transporter related (RefSeq) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
38% identity, 92% coverage: 14:234/240 of query aligns to 15:238/240 of 1ji0A
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
33% identity, 95% coverage: 8:234/240 of query aligns to 7:253/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
33% identity, 95% coverage: 8:234/240 of query aligns to 7:253/253 of 1g9xB
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
35% identity, 96% coverage: 5:234/240 of query aligns to 3:235/235 of 6mhzA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
35% identity, 96% coverage: 5:234/240 of query aligns to 3:235/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
35% identity, 96% coverage: 5:234/240 of query aligns to 3:235/238 of 6s8gA
6mbnA Lptb e163q in complex with atp (see paper)
35% identity, 96% coverage: 5:234/240 of query aligns to 4:236/241 of 6mbnA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
35% identity, 95% coverage: 5:233/240 of query aligns to 3:234/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
35% identity, 95% coverage: 5:233/240 of query aligns to 3:234/234 of 4p31A
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
34% identity, 95% coverage: 5:232/240 of query aligns to 3:233/233 of 6b8bA
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
34% identity, 90% coverage: 20:234/240 of query aligns to 17:235/240 of 6mjpA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
34% identity, 81% coverage: 18:211/240 of query aligns to 14:212/240 of 4ymuJ
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
32% identity, 87% coverage: 18:226/240 of query aligns to 16:229/242 of 3c4jA
Sites not aligning to the query:
3c41J Abc protein artp in complex with amp-pnp/mg2+
32% identity, 87% coverage: 18:226/240 of query aligns to 16:229/242 of 3c41J
Sites not aligning to the query:
2olkA Abc protein artp in complex with adp-beta-s
32% identity, 87% coverage: 18:226/240 of query aligns to 16:229/242 of 2olkA
Sites not aligning to the query:
2oljA Abc protein artp in complex with adp/mg2+
32% identity, 87% coverage: 18:226/240 of query aligns to 16:229/242 of 2oljA
Sites not aligning to the query:
P34358 ABC transporter ced-7; Cell death protein 7 from Caenorhabditis elegans (see 2 papers)
37% identity, 79% coverage: 23:212/240 of query aligns to 565:754/1704 of P34358
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
32% identity, 93% coverage: 5:226/240 of query aligns to 3:227/241 of 4u00A
3d31A Modbc from methanosarcina acetivorans (see paper)
29% identity, 91% coverage: 21:238/240 of query aligns to 16:233/348 of 3d31A
Sites not aligning to the query:
Q5SSE9 ATP-binding cassette sub-family A member 13; EC 7.6.2.- from Mus musculus (Mouse) (see paper)
32% identity, 80% coverage: 32:222/240 of query aligns to 3837:4029/5034 of Q5SSE9
Sites not aligning to the query:
>3608586 Dshi_1980 ABC transporter related (RefSeq)
MADALTITDLVAGYRPGLPILHGVSLRARAARVTVIIGPNGAGKSTLIKAIAGLVPVTSG
TIAAETEITGLRPDLLARHGIAYVPQSDNIFRTLTVRENLDLVLRHVRADAPARRAGLLD
QFPVLADKLGDKAGALSGGQRQFLAVAMALATAPSVILMDEPSAGLAPKAAQEVLEHARA
LTETGVTILLVEQNVKQALRLSDHCYILADGRNQIDGPAADLLDDPVVGQIYLGGKRVAS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory