Comparing 3608587 FitnessBrowser__Dino:3608587 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
41% identity, 96% coverage: 5:252/257 of query aligns to 4:253/253 of 1g9xB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
41% identity, 96% coverage: 5:252/257 of query aligns to 4:253/254 of 1g6hA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
33% identity, 94% coverage: 4:244/257 of query aligns to 1:227/241 of 4u00A
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
33% identity, 97% coverage: 5:254/257 of query aligns to 2:237/240 of 6mjpA
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
29% identity, 98% coverage: 1:252/257 of query aligns to 2:238/240 of 1ji0A
Q5M244 Energy-coupling factor transporter ATP-binding protein EcfA2; ECF transporter A component EcfA2; EC 3.6.3.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
33% identity, 90% coverage: 17:247/257 of query aligns to 17:239/280 of Q5M244
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
30% identity, 91% coverage: 5:239/257 of query aligns to 1:222/240 of 4ymuJ
5x40A Structure of a cbio dimer bound with amppcp (see paper)
34% identity, 99% coverage: 4:257/257 of query aligns to 3:255/280 of 5x40A
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
32% identity, 96% coverage: 6:252/257 of query aligns to 3:235/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
32% identity, 96% coverage: 6:252/257 of query aligns to 3:235/238 of 6s8gA
3c4jA Abc protein artp in complex with atp-gamma-s
29% identity, 93% coverage: 5:244/257 of query aligns to 3:229/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
29% identity, 93% coverage: 5:244/257 of query aligns to 3:229/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
29% identity, 93% coverage: 5:244/257 of query aligns to 3:229/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
29% identity, 93% coverage: 5:244/257 of query aligns to 3:229/242 of 2oljA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
32% identity, 96% coverage: 6:252/257 of query aligns to 3:235/235 of 6mhzA
6mbnA Lptb e163q in complex with atp (see paper)
31% identity, 96% coverage: 6:252/257 of query aligns to 4:236/241 of 6mbnA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
31% identity, 96% coverage: 6:251/257 of query aligns to 3:234/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
31% identity, 96% coverage: 6:251/257 of query aligns to 3:234/234 of 4p31A
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
31% identity, 95% coverage: 6:250/257 of query aligns to 3:233/233 of 6b8bA
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 88% coverage: 18:244/257 of query aligns to 18:232/343 of P30750
Sites not aligning to the query:
>3608587 FitnessBrowser__Dino:3608587
MAEPILATHGLTHDFGPFRALHGVSLEVAPGTMTGLIGPNGAGKSTLFNVLTGALRPTSG
TVTLQGTDITGQPPDALFRAGLARSFQIPRPFARMTVLENVMLAPKAQIGERVWGAFLNP
RAMAAQENAIRQKAMEVLEFVTLAKLADQAAGEISGGQMKLLELARVLMGDPTLILLDEP
AAGVNPALTEVLIDKIETLNRTGTTFVIIEHDMDFVMQHCTPVIALGQGRVIFEGTPEQA
LADPVLLDAYLGAQAHG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory