SitesBLAST
Comparing 3608642 FitnessBrowser__Dino:3608642 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
38% identity, 97% coverage: 8:253/254 of query aligns to 1:251/252 of 1vl8B
- active site: G17 (= G24), S143 (= S146), I154 (≠ G156), Y157 (= Y159), K161 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G20), R16 (≠ S23), G17 (= G24), L18 (= L25), S37 (≠ A44), R38 (= R45), C63 (≠ W66), D64 (= D67), V65 (= V68), A91 (= A94), A92 (= A95), G93 (= G96), I94 (= I97), V114 (≠ L117), I141 (≠ F144), S143 (= S146), Y157 (= Y159), K161 (= K163), P187 (= P189), G188 (= G190), Y190 (≠ F192), T192 (= T194), M194 (≠ L196), T195 (= T197)
4za2D Crystal structure of pectobacterium carotovorum 2-keto-3-deoxy-d- gluconate dehydrogenase complexed with NAD+ (see paper)
37% identity, 97% coverage: 9:254/254 of query aligns to 6:247/247 of 4za2D
- binding nicotinamide-adenine-dinucleotide: G17 (= G20), D19 (≠ S22), L22 (= L25), I42 (≠ R45), D65 (= D67), M66 (≠ V68), N92 (≠ A94), A93 (= A95), G94 (= G96), L115 (= L117), I143 (≠ F144), S145 (= S146), Y158 (= Y159), K162 (= K163), G189 (= G190), M191 (≠ F192), T193 (= T194), N195 (≠ L196)
5u9pB Crystal structure of a gluconate 5-dehydrogenase from burkholderia cenocepacia j2315 in complex with NADP and tartrate
39% identity, 96% coverage: 9:253/254 of query aligns to 12:259/261 of 5u9pB
- active site: G27 (= G24), S152 (= S146), Y165 (= Y159), K169 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G23 (= G20), R26 (≠ S23), G27 (= G24), I28 (≠ L25), R48 (= R45), D73 (= D67), V74 (= V68), N100 (≠ A94), A101 (= A95), I150 (≠ F144), Y165 (= Y159), K169 (= K163), P195 (= P189), F198 (= F192), T200 (= T194), L202 (= L196), N203 (≠ T197)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
36% identity, 96% coverage: 7:251/254 of query aligns to 1:242/244 of 4nbuB
- active site: G18 (= G24), N111 (= N118), S139 (= S146), Q149 (≠ G156), Y152 (= Y159), K156 (= K163)
- binding acetoacetyl-coenzyme a: D93 (≠ R100), K98 (≠ A105), S139 (= S146), N146 (≠ F153), V147 (≠ P154), Q149 (≠ G156), Y152 (= Y159), F184 (= F191), M189 (≠ L196), K200 (≠ E209)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G20), N17 (≠ S23), G18 (= G24), I19 (≠ L25), D38 (≠ R45), F39 (≠ R46), V59 (≠ W66), D60 (= D67), V61 (= V68), N87 (≠ A94), A88 (= A95), G89 (= G96), I90 (= I97), T137 (≠ F144), S139 (= S146), Y152 (= Y159), K156 (= K163), P182 (= P189), F184 (= F191), T185 (≠ F192), T187 (= T194), M189 (≠ L196)
3o03A Quaternary complex structure of gluconate 5-dehydrogenase from streptococcus suis type 2 (see paper)
38% identity, 96% coverage: 9:253/254 of query aligns to 7:248/254 of 3o03A
- active site: G22 (= G24), S147 (= S146), V157 (≠ G156), Y160 (= Y159), K164 (= K163)
- binding calcium ion: S147 (= S146), M148 (≠ L147), P190 (= P189)
- binding D-gluconic acid: I99 (≠ N98), R101 (= R100), S147 (= S146), M149 (≠ Q148), R154 (≠ F153), Y160 (= Y159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G20), Y21 (≠ S23), G22 (= G24), I23 (≠ L25), D42 (≠ A44), I43 (≠ R45), L47 (vs. gap), D68 (= D67), V69 (= V68), N95 (≠ A94), A96 (= A95), G97 (= G96), I145 (≠ F144), Y160 (= Y159), K164 (= K163), P190 (= P189)
3uf0A Crystal structure of a putative NAD(p) dependent gluconate 5- dehydrogenase from beutenbergia cavernae(efi target efi-502044) with bound NADP (low occupancy)
39% identity, 97% coverage: 9:254/254 of query aligns to 3:249/249 of 3uf0A
- active site: G18 (= G24), S141 (= S146), V151 (vs. gap), Y154 (= Y159), K158 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G20), S17 (= S23), G18 (= G24), I19 (≠ L25), R39 (vs. gap), D63 (= D67), L64 (≠ V68), N89 (≠ A94), G91 (= G96), I92 (= I97), I139 (≠ F144), A140 (= A145), S141 (= S146), Y154 (= Y159), K158 (= K163), P184 (= P189), G185 (= G190), V187 (≠ F192), T189 (= T194), N191 (≠ L196), T192 (= T197)
4hp8B Crystal structure of a putative 2-deoxy-d-gluconate 3-dehydrogenase from agrobacterium tumefaciens (target efi-506435) with bound NADP
40% identity, 97% coverage: 9:254/254 of query aligns to 4:246/246 of 4hp8B
- active site: G19 (= G24), S138 (= S146), V148 (vs. gap), Y151 (= Y159), K155 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G20), N17 (≠ S22), T18 (≠ S23), G19 (= G24), L20 (= L25), R40 (= R45), R41 (= R46), D63 (= D67), F64 (≠ V68), N85 (≠ A94), G87 (= G96), I88 (= I97), I136 (≠ F144), Y151 (= Y159), K155 (= K163), P181 (= P189), G182 (= G190), I184 (≠ F192), T186 (= T194), N188 (≠ L196), T189 (= T197)
A7DY56 Tropinone reductase; EC 1.1.1.206; EC 1.1.1.236 from Cochlearia officinalis (Common scurvygrass) (see paper)
34% identity, 97% coverage: 7:252/254 of query aligns to 12:261/273 of A7DY56
- Y209 (≠ V200) mutation to S: Loss of tropinone or nortropinone reduction, but faster reduction of cyclohexanones.
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
35% identity, 97% coverage: 6:251/254 of query aligns to 1:244/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G20), S17 (= S22), R18 (≠ S23), I20 (≠ L25), T40 (≠ R45), N62 (≠ D67), V63 (= V68), N89 (≠ A94), A90 (= A95), I92 (= I97), V139 (≠ F144), S141 (= S146), Y154 (= Y159), K158 (= K163), P184 (= P189), G185 (= G190), I187 (≠ F192), T189 (= T194), M191 (≠ L196)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
33% identity, 97% coverage: 6:251/254 of query aligns to 1:240/243 of 4i08A
- active site: G19 (= G24), N113 (= N118), S141 (= S146), Q151 (≠ G156), Y154 (= Y159), K158 (= K163)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G20), S17 (= S22), R18 (≠ S23), I20 (≠ L25), T40 (≠ R45), N62 (≠ D67), V63 (= V68), N89 (≠ A94), A90 (= A95), G140 (≠ A145), S141 (= S146), Y154 (= Y159), K158 (= K163), P184 (= P189), G185 (= G190), T189 (= T194)
6wprA Crystal structure of a putative 3-oxoacyl-acp reductase (fabg) with NADP(h) from acinetobacter baumannii (see paper)
32% identity, 94% coverage: 14:251/254 of query aligns to 6:241/244 of 6wprA
- active site: G16 (= G24), S138 (= S146), Y151 (= Y159)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G20), S14 (= S22), R15 (≠ S23), T37 (≠ R45), L58 (≠ W66), D59 (= D67), V60 (= V68), N86 (≠ A94), A87 (= A95), G88 (= G96), I89 (= I97), I136 (≠ F144), Y151 (= Y159), K155 (= K163), P181 (= P189)
6t62A Crystal structure of acinetobacter baumannii fabg in complex with NADPH at 1.8 a resolution (see paper)
32% identity, 94% coverage: 14:251/254 of query aligns to 6:241/244 of 6t62A
- active site: G16 (= G24), S138 (= S146), Y151 (= Y159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G20), S14 (= S22), R15 (≠ S23), A36 (= A44), T37 (≠ R45), L58 (≠ W66), D59 (= D67), V60 (= V68), N86 (≠ A94), A87 (= A95), G88 (= G96), I89 (= I97), I136 (≠ F144), S137 (≠ A145), S138 (= S146), Y151 (= Y159), K155 (= K163), P181 (= P189), G182 (= G190), I184 (≠ F192), M188 (≠ L196)
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
34% identity, 96% coverage: 9:251/254 of query aligns to 1:241/244 of P0AEK2
- GASR 12:15 (≠ GASS 20:23) binding
- T37 (≠ R45) binding
- NV 59:60 (≠ DV 67:68) binding
- N86 (≠ A94) binding
- Y151 (= Y159) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YGATK 159:163) binding
- A154 (≠ T162) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K163) mutation to A: Defect in the affinity for NADPH.
- I184 (≠ F192) binding
- E233 (≠ Q243) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
Q9ZW19 Tropinone reductase homolog At2g29360; EC 1.1.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
33% identity, 99% coverage: 1:252/254 of query aligns to 8:261/271 of Q9ZW19
- S209 (≠ V200) mutation to Y: Loss of activity with quinuclidinone and decreased activity with cyclohexanones.
2ekpA Structure of tt0495 protein from thermus thermophilus (see paper)
36% identity, 94% coverage: 14:253/254 of query aligns to 2:237/238 of 2ekpA
- active site: G12 (= G24), S128 (= S146), Y143 (= Y159), K147 (= K163)
- binding nicotinamide-adenine-dinucleotide: G8 (= G20), S10 (= S22), G12 (= G24), I13 (≠ L25), S32 (≠ A44), T49 (= T61), D50 (= D67), L51 (≠ V68), A76 (= A94), A78 (≠ G96), I126 (≠ F144), G127 (≠ A145), Y143 (= Y159), K147 (= K163), P173 (= P189), G174 (= G190), V176 (≠ F192), T178 (= T194), F180 (≠ L196), T181 (= T197)
P50163 Tropinone reductase 2; Tropinone reductase II; TR-II; EC 1.1.1.236 from Datura stramonium (Jimsonweed) (Common thornapple) (see paper)
33% identity, 98% coverage: 6:254/254 of query aligns to 2:257/260 of P50163
- 18:41 (vs. 22:45, 42% identical) binding
- S146 (= S146) binding
- IATSL 192:196 (≠ FKTEL 192:196) binding
2ae2A Tropinone reductase-ii complexed with NADP+ and pseudotropine (see paper)
33% identity, 98% coverage: 6:254/254 of query aligns to 1:256/259 of 2ae2A
- active site: G19 (= G24), S145 (= S146), Y158 (= Y159), K162 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G20), S17 (= S22), R18 (≠ S23), G19 (= G24), I20 (≠ L25), S39 (≠ A44), R40 (= R45), C64 (≠ A65), L66 (≠ V68), N93 (≠ A94), G95 (= G96), I116 (≠ L117), I143 (≠ F144), S145 (= S146), Y158 (= Y159), K162 (= K163), P188 (= P189), G189 (= G190), V190 (≠ F191), I191 (≠ F192), T193 (= T194), S194 (≠ E195), L195 (= L196), V196 (≠ T197)
- binding pseudotropine: S145 (= S146), E155 (≠ G156), Y158 (= Y159), L195 (= L196)
1ipfA Tropinone reductase-ii complexed with NADPH and tropinone (see paper)
33% identity, 98% coverage: 6:254/254 of query aligns to 1:256/259 of 1ipfA
- active site: G19 (= G24), S145 (= S146), Y158 (= Y159), K162 (= K163)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G20), R18 (≠ S23), G19 (= G24), I20 (≠ L25), S39 (≠ A44), R40 (= R45), C64 (≠ A65), D65 (= D67), L66 (≠ V68), N93 (≠ A94), S145 (= S146), Y158 (= Y159), K162 (= K163), P188 (= P189), V190 (≠ F191), I191 (≠ F192), T193 (= T194), S194 (≠ E195), L195 (= L196), V196 (≠ T197)
- binding 8-methyl-8-azabicyclo[3,2,1]octan-3-one: S147 (≠ Q148), E155 (≠ G156), Y158 (= Y159)
1ipeA Tropinone reductase-ii complexed with NADPH (see paper)
33% identity, 98% coverage: 6:254/254 of query aligns to 1:256/259 of 1ipeA
- active site: G19 (= G24), S145 (= S146), Y158 (= Y159), K162 (= K163)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G20), S17 (= S22), R18 (≠ S23), G19 (= G24), I20 (≠ L25), S39 (≠ A44), R40 (= R45), C64 (≠ A65), D65 (= D67), L66 (≠ V68), N93 (≠ A94), I116 (≠ L117), S145 (= S146), Y158 (= Y159), K162 (= K163), P188 (= P189), I191 (≠ F192), T193 (= T194), S194 (≠ E195), L195 (= L196), V196 (≠ T197)
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
34% identity, 95% coverage: 10:251/254 of query aligns to 1:240/243 of 1q7bA
- active site: G15 (= G24), E101 (≠ G110), S137 (= S146), Q147 (≠ G156), Y150 (= Y159), K154 (= K163)
- binding calcium ion: E232 (≠ Q243), T233 (≠ I244)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G20), S13 (= S22), R14 (≠ S23), T36 (≠ R45), N58 (≠ D67), V59 (= V68), N85 (≠ A94), A86 (= A95), G87 (= G96), I88 (= I97), S137 (= S146), Y150 (= Y159), K154 (= K163), P180 (= P189), G181 (= G190), I183 (≠ F192)
Query Sequence
>3608642 FitnessBrowser__Dino:3608642
MTDAPASMFDLTGRVACVTGASSGLGRRAATVLARAGASVVGVARRADALAAWEAETPGR
TASAAWDVADRDSLPDMVEAISAPFGAPDILVLAAGINNRERADAVTAAGWDATLALNLT
APFFLAQALVPAMSEKGWGRIVNFASLQTTRAFPGGVAYGATKGGIAQLTRAMAEAWSAQ
GINANAVGPGFFKTELTAPVFDNPALAQELADKTCIGRNGVPGDIDGPLLFLCSDASAYV
TGQILMVDGGFTAK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory