SitesBLAST
Comparing 3608652 FitnessBrowser__Dino:3608652 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6lpiB Crystal structure of ahas holo-enzyme (see paper)
28% identity, 89% coverage: 2:526/592 of query aligns to 5:494/539 of 6lpiB
- active site: I27 (= I24), G29 (= G26), G30 (≠ S27), S31 (≠ A28), I32 (≠ M29), E53 (= E49), C76 (≠ Q72), F115 (= F111), Q116 (= Q112), E117 (= E113), K165 (≠ R160), M256 (≠ Y252), A283 (≠ S279), V375 (≠ I406), G401 (= G432), M403 (≠ C434), D428 (= D459), N455 (= N487), A457 (≠ Q489), L458 (≠ W490), L460 (≠ A492), V461 (≠ E493), Q464 (≠ N496)
- binding flavin-adenine dinucleotide: R155 (≠ L150), G212 (= G205), G213 (≠ A206), G214 (= G207), T236 (≠ G232), L237 (≠ Y233), M238 (≠ Q234), L254 (= L250), M256 (≠ Y252), H257 (≠ N253), G276 (= G272), A277 (≠ T273), R278 (= R274), D280 (≠ N276), R282 (≠ F278), A283 (≠ S279), D300 (= D299), I301 (= I300), D319 (= D318), V320 (≠ A319), M380 (≠ A411), G398 (= G429)
- binding magnesium ion: D428 (= D459), N455 (= N487)
- binding thiamine diphosphate: E53 (= E49), C76 (≠ Q72), P79 (= P75), G376 (= G407), Q377 (≠ N408), H378 (≠ N409), G401 (= G432), M403 (≠ C434), G427 (= G458), D428 (= D459), G429 (= G460), S430 (≠ A461), M433 (≠ I464), N455 (= N487), A457 (≠ Q489), L458 (≠ W490), G459 (= G491), L460 (≠ A492), V461 (≠ E493)
6deoA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide iodomuron methyl (see paper)
26% identity, 95% coverage: 3:564/592 of query aligns to 10:555/593 of 6deoA
- active site: Y31 (≠ I24), G33 (= G26), G34 (≠ S27), A35 (= A28), I36 (≠ M29), E57 (= E49), T80 (≠ Q72), F119 (= F111), Q120 (= Q112), E121 (= E113), K169 (≠ R160), K224 (≠ A216), M260 (≠ Y252), V287 (≠ S279), V403 (≠ I406), L428 (≠ F431), G429 (= G432), M431 (≠ C434), D456 (= D459), N483 (= N487), E485 (≠ Q489), Q486 (≠ W490), M488 (≠ A492), V489 (≠ E493), W492 (≠ N496), L514 (≠ I519), N519 (≠ G524), V520 (≠ L525)
- binding flavin-adenine dinucleotide: R159 (≠ L150), G213 (= G205), A214 (= A206), G215 (= G207), N218 (≠ L210), T240 (≠ G232), L241 (≠ Y233), Q242 (= Q234), L258 (= L250), G280 (= G272), A281 (≠ T273), R282 (= R274), D284 (≠ N276), R286 (≠ F278), V287 (≠ S279), E313 (≠ D299), I314 (= I300), N318 (≠ R304), D332 (= D318), V333 (≠ A319), M408 (≠ A411), G426 (= G429)
- binding methyl 2-{[(4-iodo-6-methoxypyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: M260 (≠ Y252), D285 (≠ P277), R286 (≠ F278), M488 (≠ A492), W492 (≠ N496)
- binding magnesium ion: D456 (= D459), N483 (= N487), E485 (≠ Q489)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V403 (≠ I406), G404 (= G407), Q405 (≠ N408), H406 (≠ N409), G429 (= G432), M431 (≠ C434), G455 (= G458), D456 (= D459), A457 (≠ G460), S458 (≠ A461), M461 (≠ I464), N483 (= N487), E485 (≠ Q489), Q486 (≠ W490), G487 (= G491), M488 (≠ A492), V489 (≠ E493)
6deqA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide penoxsulam (see paper)
25% identity, 95% coverage: 3:564/592 of query aligns to 14:563/601 of 6deqA
- active site: Y35 (≠ I24), G37 (= G26), G38 (≠ S27), A39 (= A28), I40 (≠ M29), E61 (= E49), T84 (≠ Q72), F123 (= F111), Q124 (= Q112), E125 (= E113), K173 (≠ R160), K232 (≠ A216), M268 (≠ Y252), V295 (≠ S279), V411 (≠ I406), L436 (≠ F431), G437 (= G432), M439 (≠ C434), D464 (= D459), N491 (= N487), E493 (≠ Q489), Q494 (≠ W490), M496 (≠ A492), V497 (≠ E493), W500 (≠ N496), L522 (≠ I519), N527 (≠ G524), V528 (≠ L525)
- binding flavin-adenine dinucleotide: R163 (≠ L150), G221 (= G205), A222 (= A206), G223 (= G207), N226 (≠ L210), T248 (≠ G232), L249 (≠ Y233), Q250 (= Q234), L266 (= L250), G288 (= G272), A289 (≠ T273), R290 (= R274), D292 (≠ N276), R294 (≠ F278), V295 (≠ S279), E321 (≠ D299), I322 (= I300), D340 (= D318), V341 (≠ A319), M416 (≠ A411), G434 (= G429)
- binding magnesium ion: D464 (= D459), N491 (= N487), E493 (≠ Q489)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M268 (≠ Y252), R294 (≠ F278), M496 (≠ A492), V497 (≠ E493), W500 (≠ N496)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V411 (≠ I406), G412 (= G407), Q413 (≠ N408), H414 (≠ N409), M439 (≠ C434), G463 (= G458), D464 (= D459), A465 (≠ G460), S466 (≠ A461), N491 (= N487), E493 (≠ Q489), Q494 (≠ W490), G495 (= G491), M496 (≠ A492), V497 (≠ E493)
Sites not aligning to the query:
6demA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide bensulfuron methyl (see paper)
25% identity, 95% coverage: 3:564/592 of query aligns to 12:559/597 of 6demA
- active site: Y33 (≠ I24), G35 (= G26), G36 (≠ S27), A37 (= A28), I38 (≠ M29), E59 (= E49), T82 (≠ Q72), F121 (= F111), Q122 (= Q112), E123 (= E113), K171 (≠ R160), K228 (≠ A216), M264 (≠ Y252), V291 (≠ S279), V407 (≠ I406), L432 (≠ F431), G433 (= G432), M435 (≠ C434), D460 (= D459), N487 (= N487), E489 (≠ Q489), Q490 (≠ W490), M492 (≠ A492), V493 (≠ E493), W496 (≠ N496), L518 (≠ I519), N523 (≠ G524), V524 (≠ L525)
- binding methyl 2-[(4,6-dimethoxypyrimidin-2-yl)carbamoylsulfamoylmethyl]benzoate: M264 (≠ Y252), D289 (≠ P277), R290 (≠ F278), M492 (≠ A492), W496 (≠ N496)
- binding flavin-adenine dinucleotide: R161 (≠ L150), G217 (= G205), A218 (= A206), G219 (= G207), N222 (≠ L210), T244 (≠ G232), L245 (≠ Y233), Q246 (= Q234), L262 (= L250), G284 (= G272), A285 (≠ T273), R286 (= R274), D288 (≠ N276), R290 (≠ F278), V291 (≠ S279), E317 (≠ D299), I318 (= I300), N322 (≠ R304), D336 (= D318), V337 (≠ A319), M412 (≠ A411), G430 (= G429)
- binding magnesium ion: D460 (= D459), N487 (= N487), E489 (≠ Q489)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V407 (≠ I406), G408 (= G407), Q409 (≠ N408), H410 (≠ N409), M435 (≠ C434), G459 (= G458), D460 (= D459), A461 (≠ G460), S462 (≠ A461), M465 (≠ I464), N487 (= N487), E489 (≠ Q489), Q490 (≠ W490), G491 (= G491), M492 (≠ A492), V493 (≠ E493)
Sites not aligning to the query:
6delA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide chlorimuron ethyl (see paper)
25% identity, 95% coverage: 3:564/592 of query aligns to 12:559/597 of 6delA
- active site: Y33 (≠ I24), G35 (= G26), G36 (≠ S27), A37 (= A28), I38 (≠ M29), E59 (= E49), T82 (≠ Q72), F121 (= F111), Q122 (= Q112), E123 (= E113), K171 (≠ R160), K228 (≠ A216), M264 (≠ Y252), V291 (≠ S279), V407 (≠ I406), L432 (≠ F431), G433 (= G432), M435 (≠ C434), D460 (= D459), N487 (= N487), E489 (≠ Q489), Q490 (≠ W490), M492 (≠ A492), V493 (≠ E493), W496 (≠ N496), L518 (≠ I519), N523 (≠ G524), V524 (≠ L525)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: D289 (≠ P277), R290 (≠ F278), W496 (≠ N496)
- binding flavin-adenine dinucleotide: R161 (≠ L150), G217 (= G205), A218 (= A206), G219 (= G207), N222 (≠ L210), T244 (≠ G232), L245 (≠ Y233), Q246 (= Q234), L262 (= L250), G284 (= G272), A285 (≠ T273), R286 (= R274), D288 (≠ N276), R290 (≠ F278), V291 (≠ S279), E317 (≠ D299), I318 (= I300), N322 (≠ R304), D336 (= D318), V337 (≠ A319), M412 (≠ A411), G430 (= G429)
- binding (3Z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl](formyl)amino}-3-sulfanylpent-3-en-1-yl trihydrogen diphosphate: V407 (≠ I406), G408 (= G407), Q409 (≠ N408), H410 (≠ N409), G433 (= G432), M435 (≠ C434), G459 (= G458), D460 (= D459), A461 (≠ G460), S462 (≠ A461), M465 (≠ I464), N487 (= N487), E489 (≠ Q489), Q490 (≠ W490), G491 (= G491), M492 (≠ A492), V493 (≠ E493)
- binding magnesium ion: D460 (= D459), N487 (= N487), E489 (≠ Q489)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V407 (≠ I406), G408 (= G407), Q409 (≠ N408), H410 (≠ N409), G433 (= G432), M435 (≠ C434), G459 (= G458), D460 (= D459), A461 (≠ G460), S462 (≠ A461), M465 (≠ I464), N487 (= N487), E489 (≠ Q489), Q490 (≠ W490), G491 (= G491), M492 (≠ A492), V493 (≠ E493)
6desA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide propoxycarbazone (see paper)
25% identity, 95% coverage: 3:564/592 of query aligns to 12:560/598 of 6desA
- active site: Y33 (≠ I24), G35 (= G26), G36 (≠ S27), A37 (= A28), I38 (≠ M29), E59 (= E49), T82 (≠ Q72), F121 (= F111), Q122 (= Q112), E123 (= E113), K171 (≠ R160), K229 (≠ A216), M265 (≠ Y252), V292 (≠ S279), V408 (≠ I406), L433 (≠ F431), G434 (= G432), M436 (≠ C434), D461 (= D459), N488 (= N487), E490 (≠ Q489), Q491 (≠ W490), M493 (≠ A492), V494 (≠ E493), W497 (≠ N496), L519 (≠ I519), N524 (≠ G524), V525 (≠ L525)
- binding methyl 2-[(4-methyl-5-oxidanylidene-3-propoxy-1,2,4-triazol-1-yl)carbonylsulfamoyl]benzoate: M265 (≠ Y252), D290 (≠ P277), R291 (≠ F278), W497 (≠ N496)
- binding flavin-adenine dinucleotide: R161 (≠ L150), G218 (= G205), A219 (= A206), G220 (= G207), N223 (≠ L210), T245 (≠ G232), L246 (≠ Y233), Q247 (= Q234), L263 (= L250), G285 (= G272), A286 (≠ T273), R287 (= R274), D289 (≠ N276), R291 (≠ F278), V292 (≠ S279), E318 (≠ D299), I319 (= I300), N323 (≠ R304), D337 (= D318), V338 (≠ A319), Q412 (≠ C410), M413 (≠ A411), G431 (= G429)
- binding magnesium ion: D461 (= D459), N488 (= N487), E490 (≠ Q489)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V408 (≠ I406), G409 (= G407), Q410 (≠ N408), H411 (≠ N409), G434 (= G432), M436 (≠ C434), G460 (= G458), D461 (= D459), A462 (≠ G460), S463 (≠ A461), N488 (= N487), E490 (≠ Q489), Q491 (≠ W490), G492 (= G491), M493 (≠ A492), V494 (≠ E493)
6depA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide sulfometuron methyl (see paper)
25% identity, 95% coverage: 3:564/592 of query aligns to 12:560/598 of 6depA
- active site: Y33 (≠ I24), G35 (= G26), G36 (≠ S27), A37 (= A28), I38 (≠ M29), E59 (= E49), T82 (≠ Q72), F121 (= F111), Q122 (= Q112), E123 (= E113), K171 (≠ R160), K229 (≠ A216), M265 (≠ Y252), V292 (≠ S279), V408 (≠ I406), L433 (≠ F431), G434 (= G432), M436 (≠ C434), D461 (= D459), N488 (= N487), E490 (≠ Q489), Q491 (≠ W490), M493 (≠ A492), V494 (≠ E493), W497 (≠ N496), L519 (≠ I519), N524 (≠ G524), V525 (≠ L525)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D290 (≠ P277), R291 (≠ F278), M493 (≠ A492), W497 (≠ N496)
- binding flavin-adenine dinucleotide: R161 (≠ L150), G218 (= G205), A219 (= A206), G220 (= G207), N223 (≠ L210), T245 (≠ G232), L246 (≠ Y233), Q247 (= Q234), L263 (= L250), G264 (= G251), G285 (= G272), A286 (≠ T273), R287 (= R274), D289 (≠ N276), R291 (≠ F278), V292 (≠ S279), E318 (≠ D299), I319 (= I300), N323 (≠ R304), D337 (= D318), V338 (≠ A319), M413 (≠ A411), G431 (= G429)
- binding magnesium ion: D461 (= D459), N488 (= N487), E490 (≠ Q489)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V408 (≠ I406), G409 (= G407), Q410 (≠ N408), H411 (≠ N409), G434 (= G432), M436 (≠ C434), G460 (= G458), D461 (= D459), A462 (≠ G460), S463 (≠ A461), M466 (≠ I464), N488 (= N487), E490 (≠ Q489), Q491 (≠ W490), G492 (= G491), M493 (≠ A492), V494 (≠ E493)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V408 (≠ I406), G409 (= G407), Q410 (≠ N408), H411 (≠ N409), G434 (= G432), M436 (≠ C434), G460 (= G458), D461 (= D459), A462 (≠ G460), S463 (≠ A461), M466 (≠ I464), N488 (= N487), E490 (≠ Q489), Q491 (≠ W490), G492 (= G491), M493 (≠ A492), V494 (≠ E493)
6denA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide iodomuron ethyl (see paper)
25% identity, 95% coverage: 3:564/592 of query aligns to 14:561/599 of 6denA
- active site: Y35 (≠ I24), G37 (= G26), G38 (≠ S27), A39 (= A28), I40 (≠ M29), E61 (= E49), T84 (≠ Q72), F123 (= F111), Q124 (= Q112), E125 (= E113), K173 (≠ R160), K230 (≠ A216), M266 (≠ Y252), V293 (≠ S279), V409 (≠ I406), L434 (≠ F431), G435 (= G432), M437 (≠ C434), D462 (= D459), N489 (= N487), E491 (≠ Q489), Q492 (≠ W490), M494 (≠ A492), V495 (≠ E493), W498 (≠ N496), L520 (≠ I519), N525 (≠ G524), V526 (≠ L525)
- binding flavin-adenine dinucleotide: R163 (≠ L150), G219 (= G205), A220 (= A206), G221 (= G207), N224 (≠ L210), T246 (≠ G232), L247 (≠ Y233), Q248 (= Q234), L264 (= L250), G286 (= G272), A287 (≠ T273), R288 (= R274), D290 (≠ N276), R292 (≠ F278), V293 (≠ S279), E319 (≠ D299), I320 (= I300), N324 (≠ R304), D338 (= D318), V339 (≠ A319), M414 (≠ A411), G432 (= G429)
- binding ethyl 2-{[(4-iodo-6-methoxypyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: M266 (≠ Y252), D291 (≠ P277), R292 (≠ F278), W498 (≠ N496)
- binding magnesium ion: D462 (= D459), N489 (= N487), E491 (≠ Q489)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V409 (≠ I406), G410 (= G407), Q411 (≠ N408), H412 (≠ N409), G435 (= G432), M437 (≠ C434), G461 (= G458), D462 (= D459), A463 (≠ G460), S464 (≠ A461), N489 (= N487), E491 (≠ Q489), Q492 (≠ W490), G493 (= G491), M494 (≠ A492), V495 (≠ E493)
6derA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide metosulam (see paper)
25% identity, 95% coverage: 3:564/592 of query aligns to 14:562/600 of 6derA
- active site: Y35 (≠ I24), G37 (= G26), G38 (≠ S27), A39 (= A28), I40 (≠ M29), E61 (= E49), T84 (≠ Q72), F123 (= F111), Q124 (= Q112), E125 (= E113), K173 (≠ R160), K231 (≠ A216), M267 (≠ Y252), V294 (≠ S279), V410 (≠ I406), L435 (≠ F431), G436 (= G432), M438 (≠ C434), D463 (= D459), N490 (= N487), E492 (≠ Q489), Q493 (≠ W490), M495 (≠ A492), V496 (≠ E493), W499 (≠ N496), L521 (≠ I519), N526 (≠ G524), V527 (≠ L525)
- binding flavin-adenine dinucleotide: R163 (≠ L150), G220 (= G205), A221 (= A206), G222 (= G207), N225 (≠ L210), T247 (≠ G232), L248 (≠ Y233), Q249 (= Q234), L265 (= L250), H268 (≠ N253), G287 (= G272), A288 (≠ T273), R289 (= R274), D291 (≠ N276), R293 (≠ F278), V294 (≠ S279), E320 (≠ D299), I321 (= I300), N325 (≠ R304), G338 (= G317), D339 (= D318), V340 (≠ A319), Q414 (≠ C410), M415 (≠ A411), G433 (= G429)
- binding Metosulam: R293 (≠ F278), M495 (≠ A492), W499 (≠ N496)
- binding magnesium ion: D463 (= D459), N490 (= N487), E492 (≠ Q489)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V410 (≠ I406), G411 (= G407), Q412 (≠ N408), H413 (≠ N409), G436 (= G432), M438 (≠ C434), G462 (= G458), D463 (= D459), A464 (≠ G460), S465 (≠ A461), N490 (= N487), E492 (≠ Q489), Q493 (≠ W490), G494 (= G491), M495 (≠ A492), V496 (≠ E493)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V410 (≠ I406), G411 (= G407), Q412 (≠ N408), H413 (≠ N409), G436 (= G432), M438 (≠ C434), G462 (= G458), D463 (= D459), A464 (≠ G460), S465 (≠ A461), M468 (≠ I464), N490 (= N487), E492 (≠ Q489), Q493 (≠ W490), G494 (= G491), V496 (≠ E493)
Sites not aligning to the query:
6dekA Crystal structure of candida albicans acetohydroxyacid synthase catalytic subunit (see paper)
25% identity, 95% coverage: 3:564/592 of query aligns to 13:557/595 of 6dekA
- active site: Y34 (≠ I24), G36 (= G26), G37 (≠ S27), A38 (= A28), I39 (≠ M29), E60 (= E49), T83 (≠ Q72), Q118 (= Q112), E119 (= E113), K167 (≠ R160), K226 (≠ A216), M262 (≠ Y252), V289 (≠ S279), V405 (≠ I406), L430 (≠ F431), G431 (= G432), M433 (≠ C434), D458 (= D459), N485 (= N487), E487 (≠ Q489), Q488 (≠ W490), M490 (≠ A492), V491 (≠ E493), W494 (≠ N496), L516 (≠ I519), N521 (≠ G524), V522 (≠ L525)
- binding flavin-adenine dinucleotide: R157 (≠ L150), G215 (= G205), A216 (= A206), G217 (= G207), N220 (≠ L210), T242 (≠ G232), L243 (≠ Y233), Q244 (= Q234), L260 (= L250), M262 (≠ Y252), G282 (= G272), A283 (≠ T273), R284 (= R274), D286 (≠ N276), R288 (≠ F278), V289 (≠ S279), E315 (≠ D299), I316 (= I300), N320 (≠ R304), D334 (= D318), V335 (≠ A319), M410 (≠ A411), G428 (= G429)
- binding magnesium ion: D458 (= D459), N485 (= N487), E487 (≠ Q489)
- binding thiamine diphosphate: V405 (≠ I406), G406 (= G407), Q407 (≠ N408), H408 (≠ N409), M433 (≠ C434), G457 (= G458), D458 (= D459), A459 (≠ G460), S460 (≠ A461), N485 (= N487), E487 (≠ Q489), Q488 (≠ W490), G489 (= G491), M490 (≠ A492), V491 (≠ E493)
P09342 Acetolactate synthase 1, chloroplastic; ALS I; Acetohydroxy-acid synthase I; Acetolactate synthase I; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see 2 papers)
26% identity, 94% coverage: 7:563/592 of query aligns to 98:641/667 of P09342
- C161 (≠ M69) modified: Disulfide link with 307
- P194 (≠ A102) mutation to Q: In C3; highly resistant to sulfonylurea herbicides.
- C307 (≠ V208) modified: Disulfide link with 161
P09114 Acetolactate synthase 2, chloroplastic; ALS II; Acetohydroxy-acid synthase II; Acetolactate synthase II; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see paper)
26% identity, 94% coverage: 7:563/592 of query aligns to 95:638/664 of P09114
- P191 (≠ A102) mutation to A: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with L-568.
- W568 (≠ N496) mutation to L: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with A-191.
7egvA Acetolactate synthase from trichoderma harzianum with inhibitor harzianic acid (see paper)
26% identity, 94% coverage: 7:564/592 of query aligns to 11:552/590 of 7egvA
- active site: Y28 (≠ I24), G30 (= G26), G31 (≠ S27), A32 (= A28), I33 (≠ M29), E54 (= E49), T77 (≠ Q72), F116 (= F111), Q117 (= Q112), K166 (≠ R160), E220 (≠ A216), M256 (≠ Y252), V283 (≠ S279), V400 (≠ I406), L425 (≠ F431), G426 (= G432), M428 (≠ C434), Q483 (≠ W490), M485 (≠ A492), V486 (≠ E493), W489 (≠ N496), L511 (≠ I519), G516 (= G524), I517 (≠ L525)
- binding flavin-adenine dinucleotide: R156 (≠ L150), G209 (= G205), Q210 (≠ A206), G211 (= G207), T236 (≠ G232), L237 (≠ Y233), H238 (≠ Q234), G276 (= G272), S277 (≠ T273), R278 (= R274), D280 (≠ N276), R282 (≠ F278), V283 (≠ S279), E309 (≠ D299), I310 (= I300), D328 (= D318), V329 (≠ A319), M405 (≠ A411), G423 (= G429), G424 (≠ L430)
- binding (2S)-3-methyl-2-[[(2S,4R)-1-methyl-4-[(2E,4E)-octa-2,4-dienoyl]-3,5-bis(oxidanylidene)pyrrolidin-2-yl]methyl]-2-oxidanyl-butanoic acid: F493 (≠ W500), Y494 (≠ F501)
- binding magnesium ion: D453 (= D459), N480 (= N487), E482 (≠ Q489)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: P29 (≠ I25), E54 (= E49), Q117 (= Q112), V400 (≠ I406), G401 (= G407), Q402 (≠ N408), H403 (≠ N409), G426 (= G432), M428 (≠ C434), D453 (= D459), A454 (≠ G460), S455 (≠ A461), E482 (≠ Q489), Q483 (≠ W490), G484 (= G491), M485 (≠ A492), V486 (≠ E493)
1t9cA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
25% identity, 95% coverage: 3:564/592 of query aligns to 8:554/596 of 1t9cA
- active site: Y29 (≠ I24), G31 (= G26), G32 (≠ S27), A33 (= A28), I34 (≠ M29), E55 (= E49), T78 (≠ Q72), F117 (= F111), Q118 (= Q112), E119 (= E113), K167 (≠ R160), R227 (≠ A216), M263 (≠ Y252), V290 (≠ S279), V406 (≠ I406), L431 (≠ F431), G432 (= G432), M434 (≠ C434), D459 (= D459), N486 (= N487), E488 (≠ Q489), Q489 (≠ W490), M491 (≠ A492), V492 (≠ E493), W495 (≠ N496), L517 (≠ I519), G522 (= G524), L523 (= L525)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G32 (≠ S27), V107 (≠ A101), P108 (≠ A102), F117 (= F111), K167 (≠ R160), D288 (≠ P277), R289 (≠ F278), W495 (≠ N496)
- binding flavin-adenine dinucleotide: R157 (≠ A147), G216 (= G205), A217 (= A206), G218 (= G207), N221 (≠ L210), T243 (≠ G232), L244 (≠ Y233), Q245 (= Q234), L261 (= L250), M263 (≠ Y252), H264 (≠ N253), G283 (= G272), A284 (≠ T273), R285 (= R274), D287 (≠ N276), R289 (≠ F278), V290 (≠ S279), E316 (≠ D299), V317 (≠ I300), N321 (≠ R304), G334 (= G317), D335 (= D318), A336 (= A319), M411 (≠ A411), G429 (= G429), G430 (≠ L430)
- binding magnesium ion: D459 (= D459), N486 (= N487), E488 (≠ Q489)
Sites not aligning to the query:
1t9dA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
24% identity, 95% coverage: 3:564/592 of query aligns to 8:558/596 of 1t9dA
- active site: Y29 (≠ I24), G31 (= G26), G32 (≠ S27), A33 (= A28), I34 (≠ M29), E55 (= E49), T78 (≠ Q72), F117 (= F111), Q118 (= Q112), E119 (= E113), K167 (≠ R160), R227 (≠ A216), M263 (≠ Y252), V290 (≠ S279), V406 (≠ I406), L431 (≠ F431), G432 (= G432), M434 (≠ C434), D459 (= D459), N486 (= N487), E488 (≠ Q489), Q489 (≠ W490), M491 (≠ A492), V492 (≠ E493), W495 (≠ N496), L517 (≠ I519), G522 (= G524), L523 (= L525), K556 (≠ Q562)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G32 (≠ S27), A33 (= A28), V107 (≠ A101), P108 (≠ A102), F117 (= F111), K167 (≠ R160), M263 (≠ Y252), D288 (≠ P277), R289 (≠ F278), W495 (≠ N496)
- binding flavin-adenine dinucleotide: R157 (≠ A147), G216 (= G205), A217 (= A206), G218 (= G207), N221 (≠ L210), T243 (≠ G232), L244 (≠ Y233), Q245 (= Q234), M260 (≠ P249), L261 (= L250), H264 (≠ N253), G283 (= G272), A284 (≠ T273), R285 (= R274), D287 (≠ N276), R289 (≠ F278), V290 (≠ S279), E316 (≠ D299), V317 (≠ I300), N321 (≠ R304), G334 (= G317), D335 (= D318), A336 (= A319), Q410 (≠ C410), M411 (≠ A411), G429 (= G429), G430 (≠ L430)
- binding magnesium ion: D459 (= D459), N486 (= N487), E488 (≠ Q489)
- binding 2,5-dimethyl-pyrimidin-4-ylamine: E55 (= E49), P81 (= P75), Q118 (= Q112), G432 (= G432), M434 (≠ C434), M464 (≠ I464)
1t9bB Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
25% identity, 95% coverage: 3:564/592 of query aligns to 8:553/595 of 1t9bB
- active site: Y29 (≠ I24), G31 (= G26), G32 (≠ S27), A33 (= A28), I34 (≠ M29), E55 (= E49), T78 (≠ Q72), F117 (= F111), Q118 (= Q112), E119 (= E113), K167 (≠ R160), R226 (≠ A216), M262 (≠ Y252), V289 (≠ S279), V405 (≠ I406), L430 (≠ F431), G431 (= G432), M433 (≠ C434), D458 (= D459), N485 (= N487), E487 (≠ Q489), Q488 (≠ W490), M490 (≠ A492), V491 (≠ E493), W494 (≠ N496), L516 (≠ I519), G521 (= G524), L522 (= L525)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: V107 (≠ A101), P108 (≠ A102), D287 (≠ P277), R288 (≠ F278), M490 (≠ A492), W494 (≠ N496)
- binding flavin-adenine dinucleotide: R157 (≠ A147), G215 (= G205), A216 (= A206), G217 (= G207), N220 (≠ L210), T242 (≠ G232), L243 (≠ Y233), Q244 (= Q234), M259 (≠ P249), L260 (= L250), M262 (≠ Y252), H263 (≠ N253), G282 (= G272), A283 (≠ T273), R284 (= R274), D286 (≠ N276), R288 (≠ F278), V289 (≠ S279), E315 (≠ D299), V316 (≠ I300), N320 (≠ R304), G333 (= G317), D334 (= D318), A335 (= A319), Q409 (≠ C410), M410 (≠ A411), G428 (= G429), G429 (≠ L430)
- binding magnesium ion: D458 (= D459), N485 (= N487), E487 (≠ Q489)
Sites not aligning to the query:
1t9aA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
25% identity, 95% coverage: 3:564/592 of query aligns to 9:555/597 of 1t9aA
- active site: Y30 (≠ I24), G32 (= G26), G33 (≠ S27), A34 (= A28), I35 (≠ M29), E56 (= E49), T79 (≠ Q72), F118 (= F111), Q119 (= Q112), E120 (= E113), K168 (≠ R160), R228 (≠ A216), M264 (≠ Y252), V291 (≠ S279), V407 (≠ I406), L432 (≠ F431), G433 (= G432), M435 (≠ C434), D460 (= D459), N487 (= N487), E489 (≠ Q489), Q490 (≠ W490), M492 (≠ A492), V493 (≠ E493), W496 (≠ N496), L518 (≠ I519), G523 (= G524), L524 (= L525)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: G33 (≠ S27), V108 (≠ A101), P109 (≠ A102), F118 (= F111), K168 (≠ R160), M264 (≠ Y252), D289 (≠ P277), R290 (≠ F278), M492 (≠ A492), V493 (≠ E493), W496 (≠ N496)
- binding flavin-adenine dinucleotide: R158 (≠ A147), G217 (= G205), A218 (= A206), G219 (= G207), N222 (≠ L210), T244 (≠ G232), L245 (≠ Y233), Q246 (= Q234), L262 (= L250), M264 (≠ Y252), H265 (≠ N253), G284 (= G272), A285 (≠ T273), R286 (= R274), D288 (≠ N276), R290 (≠ F278), V291 (≠ S279), E317 (≠ D299), V318 (≠ I300), N322 (≠ R304), G335 (= G317), D336 (= D318), A337 (= A319), Q411 (≠ C410), M412 (≠ A411), G430 (= G429), G431 (≠ L430)
- binding magnesium ion: D460 (= D459), N487 (= N487), E489 (≠ Q489)
- binding propyl trihydrogen diphosphate: V407 (≠ I406), G408 (= G407), Q409 (≠ N408), H410 (≠ N409), M435 (≠ C434), G459 (= G458), D460 (= D459), A461 (≠ G460), S462 (≠ A461), N487 (= N487), E489 (≠ Q489), Q490 (≠ W490), G491 (= G491), M492 (≠ A492)
- binding 5-{[ethyl(methyl)amino]methyl}-2-methyl-5,6-dihydropyrimidin-4-amine: G433 (= G432), M435 (≠ C434), M465 (≠ I464)
Sites not aligning to the query:
1n0hA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorimuron ethyl (see paper)
24% identity, 95% coverage: 3:564/592 of query aligns to 10:557/599 of 1n0hA
- active site: Y31 (≠ I24), G33 (= G26), G34 (≠ S27), A35 (= A28), I36 (≠ M29), E57 (= E49), T80 (≠ Q72), F119 (= F111), Q120 (= Q112), E121 (= E113), K169 (≠ R160), R230 (≠ A216), M266 (≠ Y252), V293 (≠ S279), V409 (≠ I406), L434 (≠ F431), G435 (= G432), M437 (≠ C434), D462 (= D459), N489 (= N487), E491 (≠ Q489), Q492 (≠ W490), M494 (≠ A492), V495 (≠ E493), W498 (≠ N496), L520 (≠ I519), G525 (= G524), L526 (= L525)
- binding 4-{[(4'-amino-2'-methylpyrimidin-5'-yl)methyl]amino}pent-3-enyl diphosphate: V409 (≠ I406), G410 (= G407), Q411 (≠ N408), H412 (≠ N409), G435 (= G432), M437 (≠ C434), G461 (= G458), D462 (= D459), A463 (≠ G460), S464 (≠ A461), M467 (≠ I464), N489 (= N487), E491 (≠ Q489), Q492 (≠ W490), G493 (= G491), V495 (≠ E493)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: G34 (≠ S27), A35 (= A28), V109 (≠ A101), P110 (≠ A102), F119 (= F111), K169 (≠ R160), M266 (≠ Y252), D291 (≠ P277), R292 (≠ F278), V495 (≠ E493), W498 (≠ N496)
- binding flavin-adenine dinucleotide: R159 (≠ A147), G219 (= G205), A220 (= A206), G221 (= G207), N224 (≠ L210), T246 (≠ G232), L247 (≠ Y233), Q248 (= Q234), L264 (= L250), G265 (= G251), M266 (≠ Y252), H267 (≠ N253), G286 (= G272), A287 (≠ T273), R288 (= R274), D290 (≠ N276), R292 (≠ F278), V293 (≠ S279), E319 (≠ D299), V320 (≠ I300), N324 (≠ R304), G337 (= G317), D338 (= D318), A339 (= A319), M414 (≠ A411), G432 (= G429), G433 (≠ L430)
- binding magnesium ion: D462 (= D459), N489 (= N487), E491 (≠ Q489)
- binding thiamine diphosphate: Y31 (≠ I24), E57 (= E49), P83 (= P75)
Sites not aligning to the query:
1t9bA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
25% identity, 95% coverage: 3:564/592 of query aligns to 8:541/583 of 1t9bA
- active site: Y29 (≠ I24), G31 (= G26), G32 (≠ S27), A33 (= A28), I34 (≠ M29), E55 (= E49), T78 (≠ Q72), F117 (= F111), Q118 (= Q112), E119 (= E113), K167 (≠ R160), R214 (≠ A216), M250 (≠ Y252), V277 (≠ S279), V393 (≠ I406), L418 (≠ F431), G419 (= G432), M421 (≠ C434), D446 (= D459), N473 (= N487), E475 (≠ Q489), Q476 (≠ W490), M478 (≠ A492), V479 (≠ E493), W482 (≠ N496), L504 (≠ I519), G509 (= G524), L510 (= L525)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: V107 (≠ A101), P108 (≠ A102), F117 (= F111), D275 (≠ P277), R276 (≠ F278), M478 (≠ A492), W482 (≠ N496)
- binding flavin-adenine dinucleotide: R157 (≠ A147), G203 (= G205), A204 (= A206), G205 (= G207), N208 (≠ L210), T230 (≠ G232), L231 (≠ Y233), Q232 (= Q234), M247 (≠ P249), L248 (= L250), M250 (≠ Y252), H251 (≠ N253), G270 (= G272), A271 (≠ T273), R272 (= R274), D274 (≠ N276), R276 (≠ F278), V277 (≠ S279), E303 (≠ D299), V304 (≠ I300), N308 (≠ R304), D322 (= D318), A323 (= A319), Q397 (≠ C410), M398 (≠ A411), G416 (= G429), G417 (≠ L430)
- binding magnesium ion: D446 (= D459), N473 (= N487), E475 (≠ Q489)
Sites not aligning to the query:
1t9dB Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
25% identity, 95% coverage: 3:564/592 of query aligns to 7:540/582 of 1t9dB
- active site: Y28 (≠ I24), G30 (= G26), G31 (≠ S27), A32 (= A28), I33 (≠ M29), E54 (= E49), T77 (≠ Q72), F116 (= F111), Q117 (= Q112), E118 (= E113), K166 (≠ R160), R213 (≠ A216), M249 (≠ Y252), V276 (≠ S279), V392 (≠ I406), L417 (≠ F431), G418 (= G432), M420 (≠ C434), D445 (= D459), N472 (= N487), E474 (≠ Q489), Q475 (≠ W490), M477 (≠ A492), V478 (≠ E493), W481 (≠ N496), L503 (≠ I519), G508 (= G524), L509 (= L525)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G31 (≠ S27), A32 (= A28), V106 (≠ A101), P107 (≠ A102), F116 (= F111), K166 (≠ R160), M249 (≠ Y252), D274 (≠ P277), R275 (≠ F278), W481 (≠ N496)
- binding flavin-adenine dinucleotide: R156 (≠ A147), G202 (= G205), A203 (= A206), G204 (= G207), N207 (≠ L210), T229 (≠ G232), L230 (≠ Y233), Q231 (= Q234), L247 (= L250), M249 (≠ Y252), H250 (≠ N253), G269 (= G272), A270 (≠ T273), R271 (= R274), D273 (≠ N276), R275 (≠ F278), V276 (≠ S279), E302 (≠ D299), V303 (≠ I300), N307 (≠ R304), G320 (= G317), D321 (= D318), A322 (= A319), Q396 (≠ C410), M397 (≠ A411), G415 (= G429), G416 (≠ L430)
- binding magnesium ion: D445 (= D459), N472 (= N487), E474 (≠ Q489)
- binding 2,5-dimethyl-pyrimidin-4-ylamine: E54 (= E49), P80 (= P75), G418 (= G432), M420 (≠ C434), M450 (≠ I464)
Sites not aligning to the query:
Query Sequence
>3608652 FitnessBrowser__Dino:3608652
MRMTTEEAFIKVLQRHGVDHAFGIIGSAMMPISDLFPEAGITFWDCAHEGSAGMMADGFT
RASGRMSMMIAQNGPGITNFVTAVKTAYWNHTPLLLVTPQAANKTIGQGGFQEVAQMKLF
EDMVAYQEEVRDPSRMAEVLTRVISKAKTLSGPAQINIPRDFWTQVIDIEIPEPIEFERS
PGGEASVARAAALLSEAKNPVILNGAGVVLSEGGIAASKALAERLDAPVCVGYQHNDAFP
GGHPLFAGPLGYNGSKAAMELISEADVVLALGTRLNPFSTLPGYGMEYWPADAKIIQVDI
NSDRIGLTKKISVGIVGDAAKVARGILGQLAEDAGDAGRQERRDRIAQVKSRWAQQLSAM
DHEEDDPGTTWNARARAAKPDWMSPRMAWRAITAALPRDAIISSDIGNNCAIGNAYPDFD
APRKYLAPGLFGPCGYGLPAIVGAKIAQPDTPVVGFAGDGAFGIAVNELTAIGRGDWPAI
TQVVFRNYQWGAEKRNSTLWFDDNFVGTELDEEVSYAGIARACGLDGVVVRTMQELTDTL
ATAIKAQMTEGKTTLIEVLLNQELGEPFRRDAMKKPNKVAGVSKQDMMVEAG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory