SitesBLAST
Comparing 3608653 FitnessBrowser__Dino:3608653 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
7fj9A Kpacka (pduw) with amppnp complex structure
40% identity, 97% coverage: 10:382/385 of query aligns to 4:391/395 of 7fj9A
7fj8A Kpacka (pduw) with amp complex structure
40% identity, 97% coverage: 10:382/385 of query aligns to 4:391/395 of 7fj8A
P38502 Acetate kinase; Acetokinase; EC 2.7.2.1 from Methanosarcina thermophila (see 5 papers)
37% identity, 97% coverage: 10:383/385 of query aligns to 3:396/408 of P38502
- N7 (= N14) mutation to A: Almost abolishes catalytic activity. Requires increased magnesium levels for activity. Strongly decreases affinity for acetate.; mutation to D: Almost abolishes catalytic activity. Strongly decreases affinity for acetate.
- S10 (= S17) mutation S->A,T: Strongly decreases catalytic activity. Strongly decreases affinity for acetate.
- S12 (= S19) mutation to A: Decreases catalytic activity. Strongly decreases affinity for acetate. Requires increased magnesium levels for enzyme activity.; mutation to T: Decreases catalytic activity. Strongly decreases affinity for acetate.
- K14 (= K21) mutation to A: Strongly decreases enzyme activity.; mutation to R: Reduces enzyme activity.
- R91 (= R87) mutation R->A,L: Decreases catalytic activity. Decreases affinity for acetate.
- V93 (= V89) mutation to A: Decreases affinity for acetate.
- L122 (= L118) mutation to A: Decreases affinity for acetate.
- D148 (= D144) active site, Proton donor/acceptor; mutation D->A,E,N: Abolishes catalytic activity. Decreases affinity for acetate, but not for ATP.
- F179 (= F174) mutation to A: Decreases affinity for acetate.
- N211 (≠ S205) mutation to A: Slightly reduced enzyme activity.
- P232 (= P226) mutation to A: Decreases affinity for acetate.
- R241 (= R235) mutation R->K,L: Decreases catalytic activity. Strongly reduced affinity for ATP.
- E384 (= E371) mutation to A: Almost abolishes catalytic activity. Strongly decreases affinity for acetate. Requires strongly increased magnesium levels for enzyme activity.
1tuuB Acetate kinase crystallized with atpgs (see paper)
37% identity, 97% coverage: 10:383/385 of query aligns to 3:396/398 of 1tuuB
- active site: N7 (= N14), R91 (= R87), H180 (= H175), R241 (= R235), E384 (= E371)
- binding adenosine monophosphate: D283 (= D275), R285 (= R277), G331 (= G320), I332 (= I321), N335 (= N324), S336 (≠ A325)
- binding trihydrogen thiodiphosphate: H180 (= H175), G212 (= G206), R241 (= R235)
1tuuA Acetate kinase crystallized with atpgs (see paper)
37% identity, 97% coverage: 10:383/385 of query aligns to 3:396/399 of 1tuuA
- active site: N7 (= N14), R91 (= R87), H180 (= H175), R241 (= R235), E384 (= E371)
- binding adenosine-5'-diphosphate: K14 (= K21), G210 (= G204), D283 (= D275), F284 (≠ M276), R285 (= R277), G331 (= G320), I332 (= I321), N335 (= N324)
- binding sulfate ion: R91 (= R87), H180 (= H175), G212 (= G206)
4fwsA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with ctp (see paper)
38% identity, 97% coverage: 9:382/385 of query aligns to 3:389/394 of 4fwsA
- active site: N8 (= N14), R83 (= R87), H172 (= H175), R233 (= R235), E378 (= E371)
- binding cytidine-5'-triphosphate: G202 (= G204), N203 (≠ S205), G204 (= G206), D275 (= D275), L276 (≠ M276), R277 (= R277), G323 (= G320), I324 (= I321), N327 (= N324)
- binding 1,2-ethanediol: V21 (≠ P27), C24 (≠ A30), H115 (= H119), N203 (≠ S205), T232 (= T234), R233 (= R235), K262 (≠ N262)
4fwrA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with cmp (see paper)
38% identity, 97% coverage: 9:382/385 of query aligns to 3:389/394 of 4fwrA
- active site: N8 (= N14), R83 (= R87), H172 (= H175), R233 (= R235), E378 (= E371)
- binding cytidine-5'-monophosphate: G202 (= G204), N203 (≠ S205), D275 (= D275), L276 (≠ M276), R277 (= R277), G323 (= G320), I324 (= I321), N327 (= N324)
4fwqA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with gtp (see paper)
38% identity, 97% coverage: 9:382/385 of query aligns to 3:389/394 of 4fwqA
- active site: N8 (= N14), R83 (= R87), H172 (= H175), R233 (= R235), E378 (= E371)
- binding guanosine-5'-triphosphate: H172 (= H175), N203 (≠ S205), G204 (= G206), D275 (= D275), L276 (≠ M276), R277 (= R277), E280 (≠ M280), G323 (= G320), I324 (= I321), N327 (= N324)
4fwpA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with gdp (see paper)
38% identity, 97% coverage: 9:382/385 of query aligns to 3:389/394 of 4fwpA
- active site: N8 (= N14), R83 (= R87), H172 (= H175), R233 (= R235), E378 (= E371)
- binding 1,2-ethanediol: S11 (= S17), H115 (= H119), K262 (≠ N262)
- binding guanosine-5'-diphosphate: N203 (≠ S205), D275 (= D275), L276 (≠ M276), R277 (= R277), E280 (≠ M280), G323 (= G320), I324 (= I321), N327 (= N324), S328 (≠ A325)
4fwoA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with gmp (see paper)
38% identity, 97% coverage: 9:382/385 of query aligns to 3:389/394 of 4fwoA
- active site: N8 (= N14), R83 (= R87), H172 (= H175), R233 (= R235), E378 (= E371)
- binding guanosine-5'-monophosphate: G202 (= G204), N203 (≠ S205), D275 (= D275), L276 (≠ M276), R277 (= R277), E280 (≠ M280), G323 (= G320), I324 (= I321), N327 (= N324)
- binding 1,2-ethanediol: E100 (≠ A104), N104 (≠ E108)
4fwnA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with adenosine tetraphosphate (ap4) (see paper)
38% identity, 97% coverage: 9:382/385 of query aligns to 3:389/394 of 4fwnA
- active site: N8 (= N14), R83 (= R87), H172 (= H175), R233 (= R235), E378 (= E371)
- binding adenosine-5'-tetraphosphate: H172 (= H175), H200 (= H202), N203 (≠ S205), G204 (= G206), D275 (= D275), L276 (≠ M276), R277 (= R277), G323 (= G320), I324 (= I321), N327 (= N324)
4fwmA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with atp (see paper)
38% identity, 97% coverage: 9:382/385 of query aligns to 3:389/394 of 4fwmA
- active site: N8 (= N14), R83 (= R87), H172 (= H175), R233 (= R235), E378 (= E371)
- binding adenosine-5'-triphosphate: H172 (= H175), H200 (= H202), N203 (≠ S205), G204 (= G206), D275 (= D275), L276 (≠ M276), R277 (= R277), G323 (= G320), I324 (= I321), N327 (= N324)
- binding 1,2-ethanediol: H172 (= H175), R233 (= R235)
4fwkA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with amp (see paper)
38% identity, 97% coverage: 9:382/385 of query aligns to 3:389/394 of 4fwkA
- active site: N8 (= N14), R83 (= R87), H172 (= H175), R233 (= R235), E378 (= E371)
- binding adenosine monophosphate: G202 (= G204), N203 (≠ S205), D275 (= D275), L276 (≠ M276), R277 (= R277), G323 (= G320), I324 (= I321), N327 (= N324)
- binding 1,2-ethanediol: D103 (≠ S107), N104 (≠ E108), R107 (≠ A111)
2e1zA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with diadenosine tetraphosphate (ap4a) obtained after co- crystallization with atp (see paper)
38% identity, 97% coverage: 9:382/385 of query aligns to 3:389/394 of 2e1zA
- active site: N8 (= N14), R83 (= R87), H172 (= H175), R233 (= R235), E378 (= E371)
- binding bis(adenosine)-5'-tetraphosphate: N8 (= N14), R83 (= R87), H115 (= H119), G202 (= G204), N203 (≠ S205), G204 (= G206), P224 (= P226), R233 (= R235), D275 (= D275), L276 (≠ M276), R277 (= R277), G323 (= G320), I324 (= I321), N327 (= N324)
1x3nA Crystal structure of amppnp bound propionate kinase (tdcd) from salmonella typhimurium (see paper)
38% identity, 97% coverage: 9:382/385 of query aligns to 3:389/394 of 1x3nA
- active site: N8 (= N14), R83 (= R87), H172 (= H175), R233 (= R235), E378 (= E371)
- binding phosphoaminophosphonic acid-adenylate ester: G202 (= G204), N203 (≠ S205), G204 (= G206), D275 (= D275), L276 (≠ M276), R277 (= R277), G323 (= G320), I324 (= I321), N327 (= N324)
1x3mA Crystal structure of adp bound propionate kinase (tdcd) from salmonella typhimurium (see paper)
38% identity, 97% coverage: 9:382/385 of query aligns to 3:389/394 of 1x3mA
- active site: N8 (= N14), R83 (= R87), H172 (= H175), R233 (= R235), E378 (= E371)
- binding adenosine-5'-diphosphate: G202 (= G204), N203 (≠ S205), D275 (= D275), L276 (≠ M276), R277 (= R277), G322 (= G319), G323 (= G320), I324 (= I321), N327 (= N324)
4ijnA Crystal structure of an acetate kinase from mycobacterium smegmatis bound to amp and sulfate (see paper)
37% identity, 95% coverage: 10:376/385 of query aligns to 4:370/376 of 4ijnA
- active site: N8 (= N14), R72 (= R87), H161 (= H175), R222 (= R235), E365 (= E371)
- binding adenosine monophosphate: G191 (= G204), N192 (≠ S205), D263 (= D275), F264 (vs. gap), R265 (vs. gap), G311 (= G320), V312 (≠ I321), N315 (= N324), V316 (≠ A325)
4iz9A Crystal structure of an acetate kinase from mycobacterium avium bound to an unknown acid-apcpp conjugate and manganese (see paper)
37% identity, 97% coverage: 10:384/385 of query aligns to 6:380/381 of 4iz9A
- active site: N10 (= N14), R74 (= R87), H163 (= H175), R224 (= R235), E367 (= E371)
- binding diphosphomethylphosphonic acid adenosyl ester: K17 (= K21), G193 (= G204), N194 (≠ S205), D265 (≠ G272), F266 (≠ L273), R267 (≠ S274), G313 (= G320), I314 (= I321), N317 (= N324), D318 (≠ A325)
Query Sequence
>3608653 FitnessBrowser__Dino:3608653
MADPARSDLILVLNAGSSSLKFALFTPALAEHLTGQAESIGGPGRLKIGARSASCDLPDH
GAALAAILEALATRGITASHLKAVAHRVVHGGVRLTAPVRITPATRSEIAACSALAPLHN
PHNLAAIDRITALMPDVPQCASFDTAFHASNPEVALRYGLPDTAETAGLRRYGFHGQSYA
AMVDSWSRVTGAALPDRLLAFHLGSGASICAIRDGRSVATTMGYSPLEGLTMATRSGSID
GNAVLKLAEDHGIARARRILNNESGLAGLSGGLSDMRTLMASDRPEAGFAVDHFVYWAVR
HASSLLAPLGGTETIAFTGGIGENAAEIRARIVAGLHWIGAEIDPEANAEGQTALHSAAS
ATGIYIIPAEEERMLAADALRVLGA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory