SitesBLAST
Comparing 3608675 Dshi_2068 methylthioadenosine phosphorylase (RefSeq) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4gljA Crystal structure of methylthioadenosine phosphorylase in complex with rhodamine b (see paper)
49% identity, 85% coverage: 5:251/289 of query aligns to 6:254/287 of 4gljA
- active site: D212 (= D209), D214 (= D211)
- binding N-[9-(2-carboxyphenyl)-6-(diethylamino)-3H-xanthen-3-ylidene]-N-ethylethanaminium: S12 (= S11), Y15 (= Y14), H55 (= H54), A88 (= A87), G90 (= G89), F169 (= F165), F169 (= F165), I186 (= I183), G187 (= G184), M188 (= M185), D212 (= D209), F213 (≠ Y210), D214 (= D211), N219 (≠ D216), A228 (≠ I225), I229 (= I226), L232 (= L229)
1wtaA Crystal structure of 5'-deoxy-5'-methylthioadenosine from aeropyrum pernix (r32 form)
48% identity, 92% coverage: 1:267/289 of query aligns to 8:273/273 of 1wtaA
6dz0A Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with (3r,4s)-1-((4-amino-5h-pyrrolo[3,2- d]pyrimidin-7-yl)methyl)-4-((pent-4-yn-1-ylthio)methyl)pyrrolidin-3- ol (see paper)
45% identity, 91% coverage: 5:267/289 of query aligns to 6:273/274 of 6dz0A
- active site: T12 (≠ S11), P35 (= P34), H59 (= H58), I61 (≠ H60), M62 (≠ S61), A88 (= A87), M190 (= M185), T191 (= T186), D214 (= D209), D216 (= D211), V227 (= V222)
- binding (3R,4S)-1-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-{[(pent-4-yn-1-yl)sulfanyl]methyl}pyrrolidin-3-ol: T12 (≠ S11), H59 (= H58), A88 (= A87), C89 (= C88), G90 (= G89), F171 (= F165), I188 (= I183), N189 (≠ G184), M190 (= M185), T213 (= T208), D214 (= D209), D216 (= D211), V227 (= V222), V230 (≠ I225)
- binding phosphate ion: G11 (= G10), T12 (≠ S11), R54 (= R53), H55 (= H54), T87 (≠ S86), T191 (= T186)
5eubA Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with 2-amino-mta and sulfate
45% identity, 91% coverage: 5:267/289 of query aligns to 3:270/272 of 5eubA
- active site: T9 (≠ S11), P32 (= P34), H56 (= H58), I58 (≠ H60), M59 (≠ S61), A85 (= A87), M187 (= M185), T188 (= T186), D211 (= D209), D213 (= D211), V224 (= V222)
- binding (2~{R},3~{R},4~{S},5~{S})-2-[2,6-bis(azanyl)purin-9-yl]-5-(methylsulfanylmethyl)oxolane-3,4-diol: A85 (= A87), C86 (= C88), G87 (= G89), F168 (= F165), I185 (= I183), N186 (≠ G184), T210 (= T208), D211 (= D209), D213 (= D211), V227 (≠ I225)
6dz3A Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with (3r,4s)-1-((4-amino-5h-pyrrolo[3,2- d]pyrimidin-7-yl)methyl)-4-(((3-(1-butyl-1h-1,2,3-triazol-4-yl) propyl)thio)methyl)pyrrolidin-3-ol (see paper)
45% identity, 91% coverage: 5:267/289 of query aligns to 4:271/273 of 6dz3A
- active site: T10 (≠ S11), P33 (= P34), H57 (= H58), I59 (≠ H60), M60 (≠ S61), A86 (= A87), M188 (= M185), T189 (= T186), D212 (= D209), D214 (= D211), V225 (= V222)
- binding (3R,4S)-1-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-({[3-(1-butyl-1H-1,2,3-triazol-4-yl)propyl]sulfanyl}methyl)pyrrolidin-3-ol: T84 (≠ V85), A86 (= A87), C87 (= C88), G88 (= G89), F169 (= F165), I186 (= I183), N187 (≠ G184), M188 (= M185), D212 (= D209), D214 (= D211), V228 (≠ I225), L232 (= L229)
6dyzA Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with (3r,4s)-1-((4-amino-5h-pyrrolo[3,2- d]pyrimidin-7-yl)methyl)-4-((prop-2-yn-1-ylthio)methyl)pyrrolidin-3- ol (see paper)
45% identity, 91% coverage: 5:267/289 of query aligns to 4:271/273 of 6dyzA
- active site: T10 (≠ S11), P33 (= P34), H57 (= H58), I59 (≠ H60), M60 (≠ S61), A86 (= A87), M188 (= M185), T189 (= T186), D212 (= D209), D214 (= D211), V225 (= V222)
- binding (3R,4S)-1-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-{[(prop-2-yn-1-yl)sulfanyl]methyl}pyrrolidin-3-ol: T10 (≠ S11), H57 (= H58), A86 (= A87), C87 (= C88), G88 (= G89), F169 (= F165), I186 (= I183), N187 (≠ G184), M188 (= M185), D212 (= D209), D214 (= D211), V228 (≠ I225)
- binding phosphate ion: G9 (= G10), T10 (≠ S11), R52 (= R53), H53 (= H54), T85 (≠ S86), A86 (= A87), T189 (= T186)
5tc8A Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with methylthio-dadme-immucillin-a
45% identity, 91% coverage: 5:267/289 of query aligns to 4:271/273 of 5tc8A
- active site: T10 (≠ S11), P33 (= P34), H57 (= H58), I59 (≠ H60), M60 (≠ S61), A86 (= A87), M188 (= M185), T189 (= T186), D212 (= D209), D214 (= D211), V225 (= V222)
- binding (3r,4s)-1-[(4-amino-5h-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-[(methylsulfanyl)methyl]pyrrolidin-3-ol: T10 (≠ S11), A86 (= A87), C87 (= C88), G88 (= G89), F169 (= F165), I186 (= I183), N187 (≠ G184), M188 (= M185), T211 (= T208), D212 (= D209), D214 (= D211), V228 (≠ I225)
5tc6A Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with propylthio-immucillin-a
45% identity, 91% coverage: 5:267/289 of query aligns to 4:271/273 of 5tc6A
- active site: T10 (≠ S11), P33 (= P34), H57 (= H58), I59 (≠ H60), M60 (≠ S61), A86 (= A87), M188 (= M185), T189 (= T186), D212 (= D209), D214 (= D211), V225 (= V222)
- binding (2S,3S,4R,5S)-2-(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)-5-[(propylsulfanyl)methyl]pyrrolidine-3,4-diol: T10 (≠ S11), A86 (= A87), C87 (= C88), G88 (= G89), F169 (= F165), N187 (≠ G184), M188 (= M185), D212 (= D209), V225 (= V222), V228 (≠ I225), L229 (≠ I226)
3ozcA Crystal structure of human 5'-deoxy-5'-methyladenosine phosphorylase in complex with pcl-phenylthiodadmeimma
45% identity, 91% coverage: 5:267/289 of query aligns to 4:271/273 of 3ozcA
- active site: T10 (≠ S11), P33 (= P34), H57 (= H58), I59 (≠ H60), M60 (≠ S61), A86 (= A87), M188 (= M185), T189 (= T186), D212 (= D209), D214 (= D211), V225 (= V222)
- binding (3R,4S)-1-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-{[(4-chlorophenyl)sulfanyl]methyl}pyrrolidin-3-ol: T10 (≠ S11), H57 (= H58), A86 (= A87), C87 (= C88), G88 (= G89), F169 (= F165), I186 (= I183), N187 (≠ G184), M188 (= M185), D212 (= D209), D214 (= D211), V228 (≠ I225), L229 (≠ I226)
5tc5A Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with butylthio-dadme-immucillin-a and chloride
45% identity, 91% coverage: 5:267/289 of query aligns to 17:284/286 of 5tc5A
- active site: T23 (≠ S11), P46 (= P34), H70 (= H58), I72 (≠ H60), M73 (≠ S61), A99 (= A87), M201 (= M185), T202 (= T186), D225 (= D209), D227 (= D211), V238 (= V222)
- binding (3R,4S)-1-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-[(butylsulfanyl)methyl]pyrrolidin-3-ol: A99 (= A87), C100 (= C88), G101 (= G89), F182 (= F165), I199 (= I183), M201 (= M185), D225 (= D209), D227 (= D211), V241 (≠ I225)
1sd2A Structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase complexed with 5'-methylthiotubercidin (see paper)
46% identity, 91% coverage: 5:267/289 of query aligns to 4:260/262 of 1sd2A
- active site: T10 (≠ S11), P33 (= P34), H57 (= H58), I59 (≠ H60), M60 (≠ S61), A86 (= A87), M182 (= M185), T183 (= T186), D206 (= D209), D208 (= D211), V214 (= V222)
- binding 2-(4-amino-pyrrolo[2,3-d]pyrimidin-7-yl)-5-methylsulfanylmethyl-tetrahydro-furan-3,4-diol: C87 (= C88), G88 (= G89), F163 (= F165), I180 (= I183), N181 (≠ G184), M182 (= M185), D206 (= D209), V217 (≠ I225)
1k27A Crystal structure of 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with a transition state analogue (see paper)
45% identity, 91% coverage: 5:267/289 of query aligns to 4:268/270 of 1k27A
- active site: T10 (≠ S11), P33 (= P34), H57 (= H58), I59 (≠ H60), M60 (≠ S61), A86 (= A87), M188 (= M185), T189 (= T186), D212 (= D209), D214 (= D211), V222 (= V222)
- binding (3s,4r)-2-(4-amino-5h-pyrrolo[3,2-d]pyrimidin-7-yl)-5-[(methylsulfanyl)methyl]pyrrolidine-3,4-diol: A86 (= A87), C87 (= C88), G88 (= G89), F169 (= F165), N187 (≠ G184), M188 (= M185), D212 (= D209), V225 (≠ I225)
- binding phosphate ion: G9 (= G10), T10 (≠ S11), R52 (= R53), H53 (= H54), T85 (≠ S86), A86 (= A87), T189 (= T186)
Q8U4Q8 S-methyl-5'-thioadenosine phosphorylase; 5'-methylthioadenosine phosphorylase; MTA phosphorylase; MTAP; PfMTAP; EC 2.4.2.28 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see paper)
46% identity, 87% coverage: 5:254/289 of query aligns to 4:248/257 of Q8U4Q8
- C130 (= C133) modified: Disulfide link with 195
- C195 (= C200) modified: Disulfide link with 130
- C246 (≠ A252) modified: Disulfide link with 248
- C248 (= C254) modified: Disulfide link with 246
1sd1A Structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase complexed with formycin a (see paper)
45% identity, 91% coverage: 5:267/289 of query aligns to 4:266/268 of 1sd1A
- active site: T10 (≠ S11), P33 (= P34), H57 (= H58), I59 (≠ H60), M60 (≠ S61), A86 (= A87), M188 (= M185), T189 (= T186), D212 (= D209), D214 (= D211), V220 (= V222)
- binding (1S)-1-(7-amino-1H-pyrazolo[4,3-d]pyrimidin-3-yl)-1,4-anhydro-D-ribitol: A86 (= A87), C87 (= C88), G88 (= G89), F169 (= F165), I186 (= I183), N187 (≠ G184), M188 (= M185), D212 (= D209), D214 (= D211)
1cg6A Structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase complexed with 5'-deoxy-5'-methylthioadenosine and sulfate at 1.7 a resolution (see paper)
45% identity, 91% coverage: 5:267/289 of query aligns to 4:266/268 of 1cg6A
- active site: T10 (≠ S11), P33 (= P34), H57 (= H58), I59 (≠ H60), M60 (≠ S61), A86 (= A87), M188 (= M185), T189 (= T186), D212 (= D209), D214 (= D211), V220 (= V222)
- binding 5'-deoxy-5'-methylthioadenosine: A86 (= A87), C87 (= C88), G88 (= G89), F169 (= F165), N187 (≠ G184), M188 (= M185), D212 (= D209), V223 (≠ I225)
- binding sulfate ion: G9 (= G10), T10 (≠ S11), R52 (= R53), H53 (= H54), T85 (≠ S86), T189 (= T186)
1cb0A Structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase at 1.7 a resolution (see paper)
45% identity, 91% coverage: 5:267/289 of query aligns to 4:266/268 of 1cb0A
- active site: T10 (≠ S11), P33 (= P34), H57 (= H58), I59 (≠ H60), M60 (≠ S61), A86 (= A87), M188 (= M185), T189 (= T186), D212 (= D209), D214 (= D211), V220 (= V222)
- binding adenine: C87 (= C88), G88 (= G89), F169 (= F165), D212 (= D209), D214 (= D211)
3t94A Crystal structure of 5'-deoxy-5'-methylthioadenosine phosphorylase (mtap) ii complexed with 5'-deoxy-5'-methylthioadenosine and sulfate (see paper)
47% identity, 89% coverage: 5:262/289 of query aligns to 10:269/270 of 3t94A
- active site: S16 (= S11), P39 (= P34), H63 (= H58), I65 (≠ H60), P66 (≠ S61), A92 (= A87), M190 (= M185), T191 (= T186), D214 (= D209), D216 (= D211), A225 (≠ V222)
- binding 5'-deoxy-5'-methylthioadenosine: G94 (= G89), F170 (= F165), I188 (= I183), M190 (= M185), D214 (= D209), A225 (≠ V222), V228 (≠ I225)
Q97W94 S-methyl-5'-thioadenosine phosphorylase; 5'-methylthioadenosine phosphorylase; MTA phosphorylase; MTAP; MTAPII; EC 2.4.2.28 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 2 papers)
47% identity, 89% coverage: 5:262/289 of query aligns to 10:269/270 of Q97W94
- C138 (= C133) modified: Disulfide link with 205
- C200 (≠ R195) modified: Disulfide link with 262
- C205 (= C200) modified: Disulfide link with 138
- C259 (≠ A252) modified: Disulfide link with 261; mutation to S: Reduces thermostability of the enzyme; when associated with S-261.
- C261 (= C254) modified: Disulfide link with 259; mutation to S: Reduces thermostability of the enzyme; when associated with S-259.
- C262 (≠ P255) modified: Disulfide link with 200; mutation to S: Reduces thermostability of the enzyme.
6dz2A Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with (3r,4s)-1-((4-amino-5h-pyrrolo[3,2- d]pyrimidin-7-yl)methyl)-4-(((3-(1-benzyl-1h-1,2,3-triazol-4-yl) propyl)thio)methyl)pyrrolidin-3-ol (see paper)
44% identity, 91% coverage: 5:267/289 of query aligns to 4:268/270 of 6dz2A
- active site: T10 (≠ S11), P33 (= P34), I56 (≠ H60), M57 (≠ S61), A83 (= A87), M185 (= M185), T186 (= T186), D209 (= D209), D211 (= D211), V222 (= V222)
- binding (3R,4S)-1-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-({[3-(1-benzyl-1H-1,2,3-triazol-4-yl)propyl]sulfanyl}methyl)pyrrolidin-3-ol: G8 (= G9), T10 (≠ S11), T81 (≠ V85), T82 (≠ S86), A83 (= A87), C84 (= C88), G85 (= G89), F166 (= F165), I183 (= I183), N184 (≠ G184), M185 (= M185), D209 (= D209), L229 (= L229)
5f7jB Crystal structure of mutant n87t of adenosine/methylthioadenosine phosphorylase from schistosoma mansoni in complex with adenine (see paper)
36% identity, 86% coverage: 2:250/289 of query aligns to 3:271/291 of 5f7jB
- active site: K34 (≠ T33), H59 (= H58), D230 (= D209), D232 (= D211)
- binding adenine: A88 (= A87), C89 (= C88), G90 (= G89), F187 (= F165), V204 (≠ I183), N205 (≠ G184), M206 (= M185), D230 (= D209), D232 (= D211), V246 (≠ I225)
Query Sequence
>3608675 Dshi_2068 methylthioadenosine phosphorylase (RefSeq)
MQTYIGIIGGSGLYEIDGLEGATWTTVDSPWGTPSDAILTGTLDGVKMAFLPRHGRGHVH
SPSTVPYRANVDALKRLGVTDVISVSACGSFREEMAPGDFVIVDQFIDRTFAREKSFFGT
GCVAHVSVAHPTCPRLGAACLTAGRDAGITVHETGTYLAMEGPQFSTLAESKMYRESWGC
DVIGMTNMPEAKLAREAELCYASVAMITDYDSWHPDHGEVDVNEIIKTLMGNSEKAKGLV
ARLPKLLGADRAPCPHGCDRALDYAILTAPEKRDPALVAKLDAVAGRVL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory