SitesBLAST
Comparing 3608677 FitnessBrowser__Dino:3608677 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9CPU0 Lactoylglutathione lyase; Aldoketomutase; Glyoxalase I; Glx I; Ketone-aldehyde mutase; Methylglyoxalase; S-D-lactoylglutathione methylglyoxal lyase; EC 4.4.1.5 from Mus musculus (Mouse) (see paper)
35% identity, 91% coverage: 6:124/131 of query aligns to 34:175/184 of Q9CPU0
- Q34 (≠ H6) binding
- E100 (= E53) binding
- H127 (= H72) binding in other chain
- E173 (= E122) binding in other chain
4x2aA Crystal structure of mouse glyoxalase i complexed with baicalein (see paper)
35% identity, 91% coverage: 6:124/131 of query aligns to 20:161/167 of 4x2aA
- active site: Q20 (≠ H6), E86 (= E53), H113 (= H72), E159 (= E122)
- binding 5,6,7-trihydroxy-2-phenyl-4H-chromen-4-one: Q20 (≠ H6), F49 (= F35), L56 (= L40), F79 (vs. gap), E86 (= E53), H113 (= H72), M144 (≠ L106), E159 (= E122)
- binding zinc ion: Q20 (≠ H6), E86 (= E53), H113 (= H72), E159 (= E122)
Sites not aligning to the query:
4kykA Crystal structure of mouse glyoxalase i complexed with indomethacin (see paper)
35% identity, 91% coverage: 6:124/131 of query aligns to 29:170/179 of 4kykA
2za0A Crystal structure of mouse glyoxalase i complexed with methyl-gerfelin (see paper)
35% identity, 91% coverage: 6:124/131 of query aligns to 31:172/180 of 2za0A
- active site: Q31 (≠ H6), E97 (= E53), H124 (= H72), E170 (= E122)
- binding methyl 4-(2,3-dihydroxy-5-methylphenoxy)-2-hydroxy-6-methylbenzoate: Q31 (≠ H6), F65 (= F38), L67 (= L40), F90 (vs. gap), E97 (= E53), H124 (= H72), M155 (≠ L106), E170 (= E122)
- binding zinc ion: Q31 (≠ H6), E97 (= E53), H124 (= H72), E170 (= E122)
6l0uB Crystal structure of mouse glyoxalase i complexed with a small molecule inhibitor
35% identity, 91% coverage: 6:124/131 of query aligns to 27:168/177 of 6l0uB
- active site: Q27 (≠ H6), E93 (= E53), H120 (= H72), E166 (= E122)
- binding N-[4-(trifluoromethyloxy)phenyl]-1,3,4,9-tetrahydropyrido[3,4-b]indole-2-carbothioamide: R116 (vs. gap), K144 (≠ E99), D148 (= D103), G149 (= G104), W164 (≠ Q120)
- binding zinc ion: Q27 (≠ H6), E93 (= E53), H120 (= H72), E166 (= E122)
4kykB Crystal structure of mouse glyoxalase i complexed with indomethacin (see paper)
35% identity, 91% coverage: 6:124/131 of query aligns to 27:168/177 of 4kykB
- active site: Q27 (≠ H6), E93 (= E53), H120 (= H72), E166 (= E122)
- binding indomethacin: K144 (≠ E99), K150 (= K105), M151 (≠ L106), L154 (≠ F110), F156 (= F112)
- binding zinc ion: Q27 (≠ H6), E93 (= E53), H120 (= H72), E166 (= E122)
4kyhA Crystal structure of mouse glyoxalase i complexed with zopolrestat (see paper)
35% identity, 91% coverage: 6:124/131 of query aligns to 29:170/177 of 4kyhA
- active site: Q29 (≠ H6), E95 (= E53), H122 (= H72), E168 (= E122)
- binding zinc ion: Q29 (≠ H6), E95 (= E53), H122 (= H72), E168 (= E122)
- binding 3,4-dihydro-4-oxo-3-((5-trifluoromethyl-2-benzothiazolyl)methyl)-1-phthalazine acetic acid: M31 (= M8), R33 (= R10), F63 (= F38), E95 (= E53), T97 (= T55), N99 (= N57)
4pv5A Crystal structure of mouse glyoxalase i in complexed with 18-beta- glycyrrhetinic acid (see paper)
35% identity, 91% coverage: 6:124/131 of query aligns to 22:163/170 of 4pv5A
4opnA Crystal structure of mouse glyoxalase i complexed with mah
35% identity, 91% coverage: 6:124/131 of query aligns to 26:167/172 of 4opnA
- active site: Q26 (≠ H6), E92 (= E53), H119 (= H72), E165 (= E122)
- binding L-gamma-glutamyl-N-(3-ethynylphenyl)-N-hydroxy-L-glutaminylglycine: Q26 (≠ H6), R30 (= R10), F60 (= F38), F85 (vs. gap), E92 (= E53), T94 (= T55), N96 (= N57), R115 (vs. gap), H119 (= H72), K143 (≠ E99), K149 (= K105), M150 (≠ L106), L153 (≠ F110), E165 (= E122)
- binding zinc ion: Q26 (≠ H6), E92 (= E53)
Sites not aligning to the query:
Q04760 Lactoylglutathione lyase; Aldoketomutase; Glyoxalase I; Glx I; Ketone-aldehyde mutase; Methylglyoxalase; S-D-lactoylglutathione methylglyoxal lyase; EC 4.4.1.5 from Homo sapiens (Human) (see 12 papers)
34% identity, 91% coverage: 6:124/131 of query aligns to 34:175/184 of Q04760
- Q34 (≠ H6) binding ; mutation to E: Reduces enzyme activity by 99%.
- S45 (= S17) mutation to A: No effect on phosphorylation.
- C61 (≠ L33) modified: Disulfide link with 139, Alternate; mutation to A: No effect on NO-mediated modification.
- S69 (≠ T39) mutation to A: No effect on phosphorylation.
- S94 (vs. gap) mutation to A: No effect on phosphorylation.
- T98 (≠ E51) mutation to A: No effect on phosphorylation.
- E100 (= E53) binding ; mutation to Q: Reduces enzyme activity by over 99%.
- T102 (= T55) mutation to A: No effect on phosphorylation.
- T107 (vs. gap) modified: Phosphothreonine; mutation to A: Loss of phosphorylation.
- E111 (≠ Q60) to A: in dbSNP:rs4746
- H127 (= H72) binding in other chain
- C139 (≠ H84) modified: S-glutathionyl cysteine; alternate; modified: Disulfide link with 61, Alternate; mutation to A: Impaired NO-mediated modification. Loss of NO-mediated modification; when associated with A-19 or A-20.
- E173 (= E122) active site, Proton donor/acceptor; binding in other chain; mutation to Q: Abolishes enzyme activity.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 19 modified: Disulfide link with 20; C → Y: in dbSNP:rs17855424; C→A: No effect on NO-mediated modification. Impaired NO-mediated modification; when associated with A-20. Loss of NO-mediated modification; when associated with A-139.
- 20 modified: Disulfide link with 19; C→A: No effect on NO-mediated modification. Impaired NO-mediated modification; when associated with A-19. Loss of NO-mediated modification; when associated with A-139.
7wt0A Human glyoxalase i (with c-ter his tag) in complex with tlsc702 (see paper)
34% identity, 91% coverage: 6:124/131 of query aligns to 33:174/185 of 7wt0A
- binding (~{E})-3-(1,3-benzothiazol-2-yl)-4-(4-methoxyphenyl)but-3-enoic acid: C60 (≠ L33), F62 (= F35), L69 (= L40), F71 (≠ Y42), L92 (vs. gap), E99 (= E53), H126 (= H72), K150 (≠ E99), M157 (≠ L106), L160 (≠ F110), F162 (= F112), E172 (= E122)
- binding zinc ion: Q33 (≠ H6), E99 (= E53), H126 (= H72), E172 (= E122)
Sites not aligning to the query:
3w0uA Human glyoxalase i with an n-hydroxypyridone inhibitor
34% identity, 91% coverage: 6:124/131 of query aligns to 26:167/175 of 3w0uA
- active site: Q26 (≠ H6), E92 (= E53), H119 (= H72), E165 (= E122)
- binding N-[3-(1-Hydroxy-6-oxo-4-phenyl-1,6-dihydro-pyridin-2-yl)-5-methanesulfonylamino-phenyl]-methanesulfonamide: Q26 (≠ H6), F60 (= F38), L62 (= L40), E92 (= E53), H119 (= H72), K143 (≠ E99), M150 (≠ L106), E165 (= E122)
- binding zinc ion: Q26 (≠ H6), E92 (= E53), H119 (= H72), E165 (= E122)
Sites not aligning to the query:
3w0tA Human glyoxalase i with an n-hydroxypyridone derivative inhibitor
34% identity, 91% coverage: 6:124/131 of query aligns to 26:167/176 of 3w0tA
- active site: Q26 (≠ H6), E92 (= E53), H119 (= H72), E165 (= E122)
- binding N-[3-(1-hydroxy-6-oxo-4-phenyl-1,6-dihydropyridin-2-yl)phenyl]methanesulfonamide: Q26 (≠ H6), F55 (= F35), F60 (= F38), L62 (= L40), F64 (≠ Y42), E92 (= E53), H119 (= H72), E165 (= E122)
- binding zinc ion: Q26 (≠ H6), E92 (= E53), H119 (= H72), E165 (= E122)
Sites not aligning to the query:
3vw9A Human glyoxalase i with an n-hydroxypyridone inhibitor (see paper)
34% identity, 91% coverage: 6:124/131 of query aligns to 26:167/176 of 3vw9A
- active site: Q26 (≠ H6), E92 (= E53), H119 (= H72), E165 (= E122)
- binding 1-hydroxy-6-[1-(3-methoxypropyl)-1H-pyrrolo[2,3-b]pyridin-5-yl]-4-phenylpyridin-2(1H)-one: Q26 (≠ H6), C53 (≠ L33), L62 (= L40), E92 (= E53), H119 (= H72), M150 (≠ L106), F155 (= F112), E165 (= E122)
- binding zinc ion: Q26 (≠ H6), E92 (= E53), H119 (= H72), E165 (= E122)
Sites not aligning to the query:
1qipA Human glyoxalase i complexed with s-p- nitrobenzyloxycarbonylglutathione (see paper)
34% identity, 91% coverage: 6:124/131 of query aligns to 26:167/176 of 1qipA
- active site: Q26 (≠ H6), E92 (= E53), H119 (= H72), E165 (= E122)
- binding s-p-nitrobenzyloxycarbonylglutathione: R30 (= R10), Q51 (≠ D31), C53 (≠ L33), F60 (= F38), F64 (≠ Y42), I81 (vs. gap), L85 (vs. gap), T94 (= T55), N96 (= N57), R115 (vs. gap), M150 (≠ L106), F155 (= F112)
- binding zinc ion: Q26 (≠ H6), E92 (= E53), H119 (= H72), E165 (= E122)
Sites not aligning to the query:
1qinA Human glyoxalase i complexed with s-(n-hydroxy-n-p- iodophenylcarbamoyl) glutathione (see paper)
34% identity, 91% coverage: 6:124/131 of query aligns to 26:167/176 of 1qinA
- active site: Q26 (≠ H6), E92 (= E53), H119 (= H72), E165 (= E122)
- binding s-(n-hydroxy-n-iodophenylcarbamoyl)glutathione: Q26 (≠ H6), R30 (= R10), F60 (= F38), L62 (= L40), F64 (≠ Y42), E92 (= E53), T94 (= T55), N96 (= N57), R115 (vs. gap), H119 (= H72), K143 (≠ E99), G148 (= G104), K149 (= K105), M150 (≠ L106), E165 (= E122)
- binding zinc ion: Q26 (≠ H6), E92 (= E53)
Sites not aligning to the query:
1froA Human glyoxalase i with benzyl-glutathione inhibitor (see paper)
34% identity, 91% coverage: 6:124/131 of query aligns to 26:167/176 of 1froA
- active site: Q26 (≠ H6), E92 (= E53), H119 (= H72), E165 (= E122)
- binding s-benzyl-glutathione: R30 (= R10), F60 (= F38), T94 (= T55), N96 (= N57), R115 (vs. gap), M150 (≠ L106), F155 (= F112), E165 (= E122)
- binding zinc ion: Q26 (≠ H6), E92 (= E53), H119 (= H72), E165 (= E122)
Sites not aligning to the query:
7wszA Human glyoxalase i (with c-ter his tag) in glycerol-bound form (see paper)
34% identity, 90% coverage: 7:124/131 of query aligns to 27:167/183 of 7wszA
Sites not aligning to the query:
4mttA Ni- and zn-bound gloa2 at low resolution (see paper)
33% identity, 95% coverage: 3:126/131 of query aligns to 2:126/128 of 4mttA
1bh5A Human glyoxalase i q33e, e172q double mutant (see paper)
33% identity, 90% coverage: 7:124/131 of query aligns to 28:168/177 of 1bh5A
- active site: E93 (= E53), H120 (= H72), Q166 (≠ E122)
- binding s-hexylglutathione: R31 (= R10), F61 (= F38), L63 (= L40), T95 (= T55), N97 (= N57), R116 (vs. gap), M151 (≠ L106), F156 (= F112)
- binding zinc ion: E93 (= E53), H120 (= H72), Q166 (≠ E122)
Sites not aligning to the query:
Query Sequence
>3608677 FitnessBrowser__Dino:3608677
MAKAIHSMIRVLDEARSVDFYKRAFGLDVADRLDFSDFTLVYLSNDETGFELELTVNKGQ
TEPYDLGNGYGHFAVSVDDLDAEHARFEAEGLNPRKLVEFAPDGKLVGRFFFVADPDGYQ
IEVLERSGRFQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory