Comparing 3608685 FitnessBrowser__Dino:3608685 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6neeB Crystal structure of a reconstructed ancestor of triosephosphate isomerase from eukaryotes (see paper)
42% identity, 99% coverage: 2:245/247 of query aligns to 4:250/252 of 6neeB
P00943 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see 2 papers)
42% identity, 99% coverage: 1:245/247 of query aligns to 1:249/253 of P00943
P27876 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Bacillus subtilis (strain 168) (see paper)
40% identity, 98% coverage: 1:243/247 of query aligns to 1:247/253 of P27876
1btmA Triosephosphate isomerase (tim) complexed with 2-phosphoglycolic acid (see paper)
42% identity, 99% coverage: 2:245/247 of query aligns to 1:248/251 of 1btmA
6bveA Triosephosphate isomerase of synechocystis in complex with 2- phosphoglycolic acid (see paper)
42% identity, 98% coverage: 1:243/247 of query aligns to 1:238/242 of 6bveA
P36204 Bifunctional PGK/TIM; EC 2.7.2.3; EC 5.3.1.1 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
39% identity, 96% coverage: 2:237/247 of query aligns to 402:641/654 of P36204
Sites not aligning to the query:
6ooiC Crystal structure of triosephosphate isomerase from schistosoma mansoni in complex with 2pg (see paper)
40% identity, 99% coverage: 2:245/247 of query aligns to 8:253/255 of 6ooiC
4y96A Crystal structure of triosephosphate isomerase from gemmata obscuriglobus (see paper)
40% identity, 100% coverage: 2:247/247 of query aligns to 2:250/250 of 4y96A
4mvaA 1.43 angstrom resolution crystal structure of triosephosphate isomerase (tpia) from escherichia coli in complex with acetyl phosphate. (see paper)
41% identity, 99% coverage: 1:245/247 of query aligns to 1:248/255 of 4mvaA
B1XB85 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Escherichia coli (strain K12 / DH10B) (see paper)
41% identity, 99% coverage: 1:245/247 of query aligns to 1:248/255 of B1XB85
3uwzA Crystal structure of staphylococcus aureus triosephosphate isomerase complexed with glycerol-2-phosphate (see paper)
38% identity, 98% coverage: 1:243/247 of query aligns to 2:250/254 of 3uwzA
3uwwA Crystal structure of staphylococcus aureus triosephosphate isomerase complexed with 3-phosphoglyceric acid (see paper)
38% identity, 98% coverage: 1:243/247 of query aligns to 2:250/254 of 3uwwA
3uwvA Crystal structure of staphylococcus aureus triosephosphate isomerase complexed with 2-phosphoglyceric acid (see paper)
38% identity, 98% coverage: 1:243/247 of query aligns to 3:251/255 of 3uwvA
3uwuA Crystal structure of staphylococcus aureus triosephosphate isomerase complexed with glycerol-3-phosphate (see paper)
38% identity, 98% coverage: 1:243/247 of query aligns to 1:249/253 of 3uwuA
Q6GIL6 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Staphylococcus aureus (strain MRSA252) (see paper)
38% identity, 98% coverage: 1:243/247 of query aligns to 1:249/253 of Q6GIL6
P17751 Triosephosphate isomerase; TIM; Methylglyoxal synthase; Triose-phosphate isomerase; EC 5.3.1.1; EC 4.2.3.3 from Mus musculus (Mouse) (see paper)
38% identity, 99% coverage: 2:245/247 of query aligns to 5:247/249 of P17751
5zfxB Crystal structure of triosephosphate isomerase from opisthorchis viverrini (see paper)
40% identity, 99% coverage: 2:245/247 of query aligns to 1:246/248 of 5zfxB
P00939 Triosephosphate isomerase; TIM; Methylglyoxal synthase; Triose-phosphate isomerase; EC 5.3.1.1; EC 4.2.3.3 from Oryctolagus cuniculus (Rabbit) (see 2 papers)
38% identity, 99% coverage: 2:245/247 of query aligns to 5:247/249 of P00939
4owgA Crystal structure of rabbit muscle triosephosphate isomerase-pep complex
38% identity, 99% coverage: 2:245/247 of query aligns to 2:244/246 of 4owgA
1r2rB Crystal structure of rabbit muscle triosephosphate isomerase (see paper)
38% identity, 99% coverage: 2:245/247 of query aligns to 3:245/247 of 1r2rB
>3608685 FitnessBrowser__Dino:3608685
MRRKLAAGNWKMNGLRAALAEAEAITAAAAADGPEVLLCPPATLLAPMAAQAEGTALQIG
GQYCHPAPSGAHTGHVSAPMLRDAGASYVIVGHSERRQDDGERDADVRAQTLAAWQAGLT
AIVCVGETEAERDAANTLAIIGGQLAGSIPDTATGANLVVAYEPVWAIGTGRVPSVDQIG
EVHDFIRARLEQRFGEGVGRSVRLLYGGSVKPGIAAEIFAVSNVDGALVGGASLKAADFT
GIIAALG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory