SitesBLAST
Comparing 3608723 FitnessBrowser__Dino:3608723 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q46337 Sarcosine oxidase subunit alpha; Sarcosine oxidase subunit A; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit alpha; Tetrameric sarcosine oxidase subunit alpha; TSOX subunit alpha; EC 1.5.3.24 from Corynebacterium sp. (strain P-1) (see 2 papers)
42% identity, 100% coverage: 2:996/1000 of query aligns to 5:964/967 of Q46337
- G139 (= G178) mutation to A: Does not affect activity and binding of NAD(+).
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3ad7A Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with methylthio acetate (see paper)
42% identity, 99% coverage: 11:996/1000 of query aligns to 15:961/963 of 3ad7A
- active site: L349 (≠ I390), L374 (≠ V414), D676 (= D712)
- binding flavin mononucleotide: K509 (= K546), R510 (= R547), T516 (≠ M553), Q520 (= Q557), T548 (= T584), R550 (= R586)
- binding nicotinamide-adenine-dinucleotide: G134 (= G176), G136 (= G178), P137 (= P179), A138 (≠ S180), D157 (= D199), E158 (= E200), R159 (≠ N201), T165 (= T207), V204 (≠ A246), T248 (≠ Q289), A249 (≠ G290), S294 (= S335), F380 (≠ W420), G416 (= G456), L422 (≠ W462), D423 (≠ G463), T424 (≠ I464)
1vrqA Crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with folinic acid (see paper)
42% identity, 99% coverage: 11:996/1000 of query aligns to 15:961/963 of 1vrqA
- active site: L349 (≠ I390), L374 (≠ V414), D676 (= D712)
- binding flavin mononucleotide: K509 (= K546), R510 (= R547), T516 (≠ M553), Q520 (= Q557), T548 (= T584), R550 (= R586)
- binding N-{[4-({[(6R)-2-amino-5-formyl-4-oxo-1,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)phenyl]carbonyl}-L-glutamic acid: L631 (= L667), Y663 (= Y699), G677 (= G713), H690 (≠ T726), I774 (= I809), F776 (= F811), E783 (= E818), K822 (= K857), F824 (≠ Y859)
- binding nicotinamide-adenine-dinucleotide: G134 (= G176), G136 (= G178), P137 (= P179), A138 (≠ S180), D157 (= D199), E158 (= E200), R159 (≠ N201), T165 (= T207), V204 (≠ A246), T248 (≠ Q289), A249 (≠ G290), S294 (= S335), F380 (≠ W420), G416 (= G456), L422 (≠ W462), D423 (≠ G463), T424 (≠ I464)
Q50LF0 Sarcosine oxidase subunit alpha; Sarcosine oxidase subunit A; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit alpha; Tetrameric sarcosine oxidase subunit alpha; TSOX subunit alpha; EC 1.5.3.24 from Corynebacterium sp. (strain U-96) (see 2 papers)
42% identity, 99% coverage: 11:996/1000 of query aligns to 16:962/965 of Q50LF0
- A139 (≠ S180) binding
- D158 (= D199) binding
- E159 (= E200) binding
- R160 (≠ N201) binding
- T166 (= T207) binding
- V205 (≠ A246) binding
- A418 (= A457) binding
- L423 (≠ W462) binding
- T425 (≠ I464) binding
2gagA Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution (see paper)
42% identity, 99% coverage: 9:996/1000 of query aligns to 14:962/965 of 2gagA
- active site: L350 (≠ I390), L375 (≠ V414), D677 (= D712)
- binding flavin mononucleotide: K510 (= K546), R511 (= R547), T517 (≠ M553), Q521 (= Q557), T549 (= T584), R551 (= R586)
- binding 2-furoic acid: N647 (= N682), G653 (≠ P688), T655 (= T690), K851 (= K885)
- binding nicotinamide-adenine-dinucleotide: V134 (= V175), G135 (= G176), G137 (= G178), P138 (= P179), A139 (≠ S180), D158 (= D199), E159 (= E200), R160 (≠ N201), G165 (= G206), T166 (= T207), T204 (= T245), V205 (≠ A246), T249 (≠ Q289), G250 (= G290), S295 (= S335), F381 (≠ W420), G417 (= G456), A418 (= A457), L423 (≠ W462), D424 (≠ G463), T425 (≠ I464), Y554 (= Y589)
1worA Crystal structure of t-protein of the glycine cleavage system (see paper)
28% identity, 38% coverage: 610:990/1000 of query aligns to 2:356/362 of 1worA
1wopA Crystal structure of t-protein of the glycine cleavage system (see paper)
28% identity, 38% coverage: 610:990/1000 of query aligns to 2:356/362 of 1wopA
- active site: D96 (= D712)
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: M51 (≠ L667), L55 (≠ E671), Y83 (= Y699), D96 (= D712), V98 (= V714), E106 (≠ L722), L108 (≠ H724), V110 (≠ T726), N112 (≠ T728), I137 (≠ T757), E160 (= E780), Y168 (≠ H791), Y169 (≠ M792), K173 (≠ E796), S174 (≠ C797), I175 (≠ T798), E180 (≠ P803), T181 (≠ S804), Y188 (≠ F811), E195 (= E818), M197 (≠ N820), R227 (≠ M850), Y236 (= Y859)
Sites not aligning to the query:
1wooA Crystal structure of t-protein of the glycine cleavage system (see paper)
28% identity, 38% coverage: 610:990/1000 of query aligns to 2:356/362 of 1wooA
- active site: D96 (= D712)
- binding (6s)-5,6,7,8-tetrahydrofolate: M51 (≠ L667), Y83 (= Y699), D96 (= D712), V98 (= V714), V110 (≠ T726), N112 (≠ T728), Y168 (≠ H791), Y169 (≠ M792), Y188 (≠ F811), E195 (= E818), Y236 (= Y859)
Sites not aligning to the query:
Q9AGP8 Dimethylglycine oxidase; DMGO; EC 1.5.3.10 from Arthrobacter globiformis (see 2 papers)
29% identity, 39% coverage: 610:998/1000 of query aligns to 431:829/830 of Q9AGP8
- Y539 (= Y699) binding
- D552 (= D712) Important for catalytic activity; mutation to A: No effect on the activity.; mutation to N: Reduces activity 3-fold.
Sites not aligning to the query:
- 14:15 binding
- 35:36 binding
- 45:48 binding
- 52 binding
- 174 binding
- 225 Important for catalytic activity; H→Q: Reduces catalytic efficiency 3-fold and substrate affinity 30-fold.
- 259 Important for catalytic activity; binding ; Y→F: Reduces catalytic efficiency 225-fold and substrate affinity 25-fold.
- 360:363 binding
1pj7A Structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folinic acid (see paper)
29% identity, 39% coverage: 610:998/1000 of query aligns to 428:826/827 of 1pj7A
- active site: D549 (= D712)
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: L505 (= L667), Y536 (= Y699), D549 (= D712), T551 (≠ V714), G563 (vs. gap), F629 (≠ M792), Y648 (≠ F811), E655 (= E818), Y696 (= Y859)
Sites not aligning to the query:
- active site: 222, 256
- binding flavin-adenine dinucleotide: 8, 10, 11, 12, 32, 33, 41, 42, 43, 45, 47, 49, 170, 171, 200, 201, 203, 222, 256, 331, 357, 358, 359, 360
1pj6A Crystal structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folic acid (see paper)
29% identity, 39% coverage: 610:998/1000 of query aligns to 429:827/828 of 1pj6A
Sites not aligning to the query:
- active site: 223, 257
- binding flavin-adenine dinucleotide: 9, 11, 12, 13, 33, 34, 42, 43, 44, 46, 48, 50, 172, 201, 202, 204, 223, 257, 331, 332, 358, 359, 360, 361
Q8GAI3 4-methylaminobutanoate oxidase (formaldehyde-forming); MABO; Demethylating gamma-N-methylaminobutyrate oxidase; Gamma-N-methylaminobutyrate oxidase 1; EC 1.5.3.19 from Paenarthrobacter nicotinovorans (Arthrobacter nicotinovorans) (see paper)
31% identity, 39% coverage: 609:998/1000 of query aligns to 437:823/824 of Q8GAI3
Sites not aligning to the query:
- 66 mutation W->F,S: Contains a non-covalently bound FAD. Loss of enzyme activity.
- 67 H→A: Contains a non-covalently bound FAD. Exhibits about 10% of the wild-type enzyme activity.
3gsiA Crystal structure of d552a dimethylglycine oxidase mutant of arthrobacter globiformis in complex with tetrahydrofolate (see paper)
29% identity, 39% coverage: 610:998/1000 of query aligns to 428:826/827 of 3gsiA
- active site: A549 (≠ D712)
- binding (6s)-5,6,7,8-tetrahydrofolate: L505 (= L667), Y536 (= Y699), T551 (≠ V714), G563 (vs. gap), F629 (≠ M792), Y648 (≠ F811), E655 (= E818), Y696 (= Y859)
Sites not aligning to the query:
- active site: 222, 256
- binding flavin-adenine dinucleotide: 10, 11, 12, 32, 33, 41, 42, 43, 45, 47, 49, 170, 171, 200, 201, 203, 222, 256, 330, 331, 332, 357, 358, 359, 360
- binding magnesium ion: 254, 409
Q9UI17 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Homo sapiens (Human) (see 4 papers)
25% identity, 37% coverage: 631:998/1000 of query aligns to 490:858/866 of Q9UI17
- A530 (≠ G660) to G: in dbSNP:rs1805073
- S646 (≠ G781) to P: in dbSNP:rs1805074
Sites not aligning to the query:
- 59:60 binding
- 80:81 binding
- 87:95 binding
- 91 modified: Tele-8alpha-FAD histidine
- 109 H → R: in DMGDHD; shows 10 fold lower catalytic efficiency due to lower cofactor saturation and reduced thermal stability; dbSNP:rs121908331
- 219 binding
- 279 S → P: in dbSNP:rs532964
- 397:402 binding
Q63342 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Rattus norvegicus (Rat) (see 2 papers)
27% identity, 33% coverage: 631:959/1000 of query aligns to 483:811/857 of Q63342
Sites not aligning to the query:
- 52:53 binding
- 73:74 binding
- 80:88 binding
- 84 modified: Tele-8alpha-FAD histidine
- 212 binding
- 244 binding
- 390:395 binding
4pabB Crystal structure of the precursor form of rat dmgdh complexed with tetrahydrofolate (see paper)
27% identity, 33% coverage: 631:959/1000 of query aligns to 446:774/824 of 4pabB
- active site: E536 (≠ D712)
- binding (6s)-5,6,7,8-tetrahydrofolate: I523 (≠ C697), E536 (≠ D712), T538 (≠ V714), I550 (≠ T726), F612 (≠ H791), L613 (≠ M792), Y632 (≠ F811), E639 (= E818), F680 (≠ Y859), Y700 (≠ W879)
Sites not aligning to the query:
- active site: 53, 102, 226, 255
- binding flavin-adenine dinucleotide: 11, 12, 14, 15, 16, 35, 36, 37, 43, 44, 45, 47, 48, 49, 50, 51, 175, 204, 205, 207, 226, 228, 326, 328, 353, 355, 356, 357, 358
3a8iA Crystal structure of et-ehred-5-ch3-thf complex (see paper)
29% identity, 34% coverage: 651:989/1000 of query aligns to 35:355/363 of 3a8iA
- active site: D97 (= D712)
- binding 5-methyl-5,6,7,8-tetrahydrofolic acid: M51 (≠ L667), Y84 (= Y699), D97 (= D712), I99 (≠ V714), V111 (≠ T726), N113 (≠ T728), F173 (≠ V795), Y188 (≠ F811), E195 (= E818), R223 (≠ M850), M232 (≠ Y859), W252 (= W879)
P48728 Aminomethyltransferase, mitochondrial; Glycine cleavage system T protein; GCVT; EC 2.1.2.10 from Homo sapiens (Human) (see 4 papers)
25% identity, 37% coverage: 607:972/1000 of query aligns to 31:378/403 of P48728
- D129 (= D712) mutation D->A,N: Loss of aminomethyltransferase activity.
- N145 (≠ T728) to I: in GCE2; loss of aminomethyltransferase activity; dbSNP:rs386833682
- E232 (= E818) binding
- R261 (≠ M850) binding
- G269 (= G858) to D: in GCE2; decreased aminomethyltransferase activity; dbSNP:rs121964981
- R320 (≠ P915) to H: in GCE2; loss of aminomethyltransferase activity; dbSNP:rs121964985
Sites not aligning to the query:
1wsvA Crystal structure of human t-protein of glycine cleavage system (see paper)
25% identity, 37% coverage: 608:972/1000 of query aligns to 1:347/371 of 1wsvA
- active site: D98 (= D712)
- binding n-[4-({[(6s)-2-amino-4-hydroxy-5-methyl-5,6,7,8-tetrahydropteridin-6-yl]methyl}amino)benzoyl]-l-glutamic acid: M53 (≠ L667), L85 (≠ Y699), D98 (= D712), L99 (≠ G713), I100 (≠ V714), V112 (≠ T726), N114 (≠ T728), F173 (≠ H791), G193 (≠ S810), Y194 (≠ F811), E201 (= E818), R230 (≠ M850), L239 (≠ Y859)
Sites not aligning to the query:
A0A1J1EM40 Sesamin methylene transferase; Sesamin-metabolizing enzyme; THF-dependent sesamin/sesamin-monocatechol methylenetransferase; EC 2.1.5.1 from Sinomonas sp. (strain No.22) (see paper)
25% identity, 23% coverage: 671:896/1000 of query aligns to 54:304/452 of A0A1J1EM40
- D95 (= D712) mutation to A: 60% decrease in activity.
- E189 (= E818) mutation to A: Loss of activity.
- Y221 (≠ M850) mutation to A: Loss of activity.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
Query Sequence
>3608723 FitnessBrowser__Dino:3608723
MTEYRVEGRGRVNRKTPVRFTFDGQTYEGLKGDTVASALLANGVHLMGRSFKYHRPRGVV
TAGSEEPNALVGTTRGKGRFEPNTRATIQEIYPGLETESQNKWPSLKFDLGAINDRLYML
FSAGFYYKTFMWPRSFWDSVYEPLIRKAAGLGKAPTEVDPDTYASRYMHCDVLVVGSGPS
GIAAALTAGRAGSKVVLVDENAEMGGTLLSEPSVSIDGQPAWEWLEGAMAELDRMPNVRR
MTRTTAMGYYHQNMIGMVEKLTDHMAEIPEGAPRERMWRVRAREVVLAQGAIERPMVFDG
NDTPGILMAGAAQTFLNRFGVLVGKSPVVLTSHDSAWYSAFDMADAGASVVAIVDTRNDV
SQALRDEAQARGLKTYLGYTATGTKGRLRIKALRVNPVRDGKVGAGHLLFCDAVLMCGGW
TPSLHLFSHTKGSLHWDAESKAYLPGKKSEDVHIAGAGRGLWGIASALEDGAKAGAAAVQ
SLGGSAGSATYAVADDRTGTGVTQKELPTDRSPGKAKAFVDFQNDVTAKDIRLAVREGMK
SIEHVKRYTTNGMATDQGKLSNMNGLTIAADALGKEAPQVGLTTFRPPYTPTTFGAFCGY
HKGAHFEVTRKTPIDPWAEEHGAAFEPVALWRRAWYFPQAGEDMHKAVARECKSTRESVG
MFDASTLGKIEVSGPDAVEFMNRMYTNPWTKLGVGRCRYGLLLGEDGFIRDDGVIGRMRD
DLFHVTTTTGGAARVLNMMEDYLQTEWPELKVWLTSTTEEWATIALNGPNARKLLAPFVE
GADISADAFPHMSVVECTVAGFPSRLFRISFTGELGFEINVPARHGKALWEKLWEAGQQY
DICPYGTETMHVLRAEKGYIIVGQDTDGTVTPQDAGIGWAIGKAKPDFVGKRSLQRPDIV
APGRKQLVGLLTEDPKTVLAEGAQIVDDPKQAKPMKMIGHVTSSYWSETLGRSIAMAVVE
GGFDRMDSTLHIPTESGDAVPAKVTGTVFYDPAGDRLKVE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory