SitesBLAST
Comparing 3608728 FitnessBrowser__Dino:3608728 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
42% identity, 84% coverage: 15:328/376 of query aligns to 7:331/375 of 2d62A
1g291 Malk (see paper)
47% identity, 66% coverage: 15:262/376 of query aligns to 4:256/372 of 1g291
- binding magnesium ion: D69 (= D74), E71 (= E76), K72 (≠ Q77), K79 (≠ W84), D80 (= D85)
- binding pyrophosphate 2-: S38 (= S49), G39 (= G50), C40 (= C51), G41 (= G52), K42 (= K53), T43 (= T54), T44 (= T55)
Sites not aligning to the query:
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
39% identity, 96% coverage: 2:361/376 of query aligns to 6:365/378 of P69874
- C26 (≠ R23) mutation to A: Lower ATPase activity and transport efficiency.
- F27 (= F24) mutation to L: Lower ATPase activity and transport efficiency.
- F45 (= F42) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (= C51) mutation to T: Loss of ATPase activity and transport.
- L60 (= L57) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (= L73) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (≠ M132) mutation to M: Loss of ATPase activity and transport.
- D172 (= D169) mutation to N: Loss of ATPase activity and transport.
- C276 (≠ T273) mutation to A: Lower ATPase activity and transport efficiency.
- E297 (= E296) mutation E->K,D: Lower ATPase activity and transport efficiency.; mutation to Q: Loss of ATPase activity and transport.
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
46% identity, 76% coverage: 15:298/376 of query aligns to 7:278/353 of 1vciA
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
49% identity, 62% coverage: 15:247/376 of query aligns to 4:237/393 of P9WQI3
- H193 (= H203) mutation to A: Decreased hydrolysis of ATP. No change in KM, but 2-fold reduction in Vmax compared to wild-type.
8hplC Lpqy-sugabc in state 1 (see paper)
48% identity, 62% coverage: 15:247/376 of query aligns to 3:234/384 of 8hplC
8hprC Lpqy-sugabc in state 4 (see paper)
46% identity, 69% coverage: 15:275/376 of query aligns to 3:260/363 of 8hprC
- binding adenosine-5'-triphosphate: Y12 (≠ F24), S38 (= S49), G39 (= G50), G41 (= G52), K42 (= K53), S43 (≠ T54), Q82 (= Q93), Q133 (= Q144), G136 (= G147), G137 (= G148), Q138 (= Q149), H192 (= H203)
- binding magnesium ion: S43 (≠ T54), Q82 (= Q93)
8hprD Lpqy-sugabc in state 4 (see paper)
46% identity, 69% coverage: 15:275/376 of query aligns to 3:260/362 of 8hprD
- binding adenosine-5'-triphosphate: Y12 (≠ F24), S38 (= S49), C40 (= C51), G41 (= G52), K42 (= K53), S43 (≠ T54), T44 (= T55), Q82 (= Q93), R129 (= R140), Q133 (= Q144), S135 (= S146), G136 (= G147), G137 (= G148), Q159 (≠ E170), H192 (= H203)
- binding magnesium ion: S43 (≠ T54), Q82 (= Q93)
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
45% identity, 63% coverage: 15:250/376 of query aligns to 3:238/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ F24), S37 (= S49), G38 (= G50), C39 (= C51), G40 (= G52), K41 (= K53), S42 (≠ T54), T43 (= T55), Q81 (= Q93), R128 (= R140), A132 (≠ Q144), S134 (= S146), G136 (= G148), Q137 (= Q149), E158 (= E170), H191 (= H203)
- binding magnesium ion: S42 (≠ T54), Q81 (= Q93)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
45% identity, 63% coverage: 15:250/376 of query aligns to 3:238/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ F24), G38 (= G50), C39 (= C51), G40 (= G52), K41 (= K53), S42 (≠ T54), T43 (= T55), R128 (= R140), S134 (= S146), Q137 (= Q149)
- binding beryllium trifluoride ion: S37 (= S49), G38 (= G50), K41 (= K53), Q81 (= Q93), S134 (= S146), G136 (= G148), H191 (= H203)
- binding magnesium ion: S42 (≠ T54), Q81 (= Q93)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
45% identity, 63% coverage: 15:250/376 of query aligns to 3:238/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ F24), V17 (≠ A29), G38 (= G50), C39 (= C51), G40 (= G52), K41 (= K53), S42 (≠ T54), T43 (= T55), R128 (= R140), A132 (≠ Q144), S134 (= S146), Q137 (= Q149)
- binding tetrafluoroaluminate ion: S37 (= S49), G38 (= G50), K41 (= K53), Q81 (= Q93), S134 (= S146), G135 (= G147), G136 (= G148), E158 (= E170), H191 (= H203)
- binding magnesium ion: S42 (≠ T54), Q81 (= Q93)
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
45% identity, 63% coverage: 15:250/376 of query aligns to 3:238/371 of 3puvA
- binding adenosine-5'-diphosphate: W12 (≠ F24), V17 (≠ A29), G38 (= G50), C39 (= C51), G40 (= G52), K41 (= K53), S42 (≠ T54), T43 (= T55), R128 (= R140), A132 (≠ Q144), S134 (= S146), Q137 (= Q149)
- binding magnesium ion: S42 (≠ T54), Q81 (= Q93)
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
45% identity, 63% coverage: 15:250/376 of query aligns to 3:238/374 of 2awnB
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
45% identity, 63% coverage: 15:250/376 of query aligns to 4:239/371 of P68187
- A85 (= A96) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ G117) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (≠ A125) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ W128) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (≠ D130) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ T135) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G148) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D169) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
- R228 (= R239) mutation to C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
Sites not aligning to the query:
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
45% identity, 63% coverage: 15:250/376 of query aligns to 1:236/367 of 1q12A
- binding adenosine-5'-triphosphate: W10 (≠ F24), S35 (= S49), G36 (= G50), C37 (= C51), G38 (= G52), K39 (= K53), S40 (≠ T54), T41 (= T55), R126 (= R140), A130 (≠ Q144), S132 (= S146), G134 (= G148), Q135 (= Q149)
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
44% identity, 63% coverage: 15:250/376 of query aligns to 4:239/369 of P19566
- L86 (= L97) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P171) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (= D176) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
Sites not aligning to the query:
- 306 E→K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
3d31A Modbc from methanosarcina acetivorans (see paper)
36% identity, 94% coverage: 14:368/376 of query aligns to 1:347/348 of 3d31A
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
41% identity, 65% coverage: 1:245/376 of query aligns to 16:263/382 of 7ahhC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
- binding phosphoaminophosphonic acid-adenylate ester: 12
7aheC Opua inhibited inward facing (see paper)
41% identity, 65% coverage: 1:245/376 of query aligns to 16:263/382 of 7aheC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
7ahdC Opua (e190q) occluded (see paper)
41% identity, 64% coverage: 1:241/376 of query aligns to 16:259/260 of 7ahdC
- binding adenosine-5'-triphosphate: T39 (≠ F27), S61 (= S49), G62 (= G50), G64 (= G52), K65 (= K53), S66 (≠ T54), T67 (= T55), Q111 (= Q93), K161 (≠ N143), Q162 (= Q144), S164 (= S146), G166 (= G148), M167 (≠ Q149), Q188 (≠ E170), H221 (= H203)
Sites not aligning to the query:
Query Sequence
>3608728 FitnessBrowser__Dino:3608728
MKANAQMDQSSEPIVKFDNVVKRFGSFTAVKKADFEIGRGEFLAIMGSSGCGKTTTLRML
AGLEDPTEGAIYLDGEQVNGKATWDRDTPMVWQSLALFPFLTVQENVEFALKMRGIGKEE
RRQRADKWLDKMQITEFADRNINQLSGGQKQRVALARALVTEPKILLLDEPLSALDAHLK
VRMQSVLSNLQKDLGITFVYVTHSMSEAFSMADRVVIMSRGQIEQIGTPEEIYREPHNRF
VAEFLGSANIFDGVVEGPAEDGGWRVSYEGGETVLDKSELAEARKGQAVTFIVSAENMQL
SLPDSGQPGIAASVAGEEFIGGTAMVFLETATGQELKVQKTHEELSQLDLHAGSRIIVHW
APDSCHVLPGETGARN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory