Comparing 3608763 FitnessBrowser__Dino:3608763 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1phpA Structure of the adp complex of the 3-phosphoglycerate kinase from bacillus stearothermophilus at 1.65 angstroms (see paper)
49% identity, 99% coverage: 1:391/393 of query aligns to 1:392/394 of 1phpA
P18912 Phosphoglycerate kinase; EC 2.7.2.3 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see paper)
49% identity, 99% coverage: 1:391/393 of query aligns to 1:392/394 of P18912
P36204 Bifunctional PGK/TIM; EC 2.7.2.3; EC 5.3.1.1 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
48% identity, 99% coverage: 1:390/393 of query aligns to 1:394/654 of P36204
1vpeA Crystallographic analysis of phosphoglycerate kinase from the hyperthermophilic bacterium thermotoga maritima (see paper)
48% identity, 98% coverage: 5:390/393 of query aligns to 4:393/398 of 1vpeA
P40924 Phosphoglycerate kinase; EC 2.7.2.3 from Bacillus subtilis (strain 168) (see paper)
46% identity, 99% coverage: 1:390/393 of query aligns to 1:391/394 of P40924
4feyA An x-ray structure of a putative phosphogylcerate kinase with bound adp from francisella tularensis subsp. Tularensis schu s4
45% identity, 99% coverage: 1:391/393 of query aligns to 1:387/392 of 4feyA
4ng4B Structure of phosphoglycerate kinase (cbu_1782) from coxiella burnetii (see paper)
44% identity, 98% coverage: 5:390/393 of query aligns to 4:384/389 of 4ng4B
P0A799 Phosphoglycerate kinase; EC 2.7.2.3 from Escherichia coli (strain K12) (see 3 papers)
44% identity, 99% coverage: 1:391/393 of query aligns to 1:382/387 of P0A799
1zmrA Crystal structure of the e. Coli phosphoglycerate kinase (see paper)
44% identity, 98% coverage: 6:391/393 of query aligns to 5:381/386 of 1zmrA
P07378 Phosphoglycerate kinase, glycosomal; Phosphoglycerate kinase C; EC 2.7.2.3 from Trypanosoma brucei brucei (see 2 papers)
40% identity, 99% coverage: 4:391/393 of query aligns to 7:417/440 of P07378
16pkA Phosphoglycerate kinase from trypanosoma brucei bisubstrate analog (see paper)
40% identity, 99% coverage: 4:391/393 of query aligns to 3:413/415 of 16pkA
13pkA Ternary complex of phosphoglycerate kinase from trypanosoma brucei (see paper)
40% identity, 99% coverage: 4:391/393 of query aligns to 3:413/415 of 13pkA
3zlbA Crystal structure of phosphoglycerate kinase from streptococcus pneumoniae (see paper)
42% identity, 98% coverage: 5:390/393 of query aligns to 5:395/398 of 3zlbA
Sites not aligning to the query:
6yjeA Plasmoodium vivax phosphoglycerate kinase bound to nitrofuran inhibitor from peg3350 and ammonium acetate at ph 5.5
39% identity, 98% coverage: 7:392/393 of query aligns to 10:415/416 of 6yjeA
P09041 Phosphoglycerate kinase 2; Phosphoglycerate kinase, testis specific; EC 2.7.2.3 from Mus musculus (Mouse) (see paper)
40% identity, 98% coverage: 5:390/393 of query aligns to 8:414/417 of P09041
2paaA Crystal structure of phosphoglycerate kinase-2 bound to atp and 3pg (see paper)
40% identity, 98% coverage: 5:390/393 of query aligns to 4:410/413 of 2paaA
2wzcA The catalytically active fully closed conformation of human phosphoglycerate kinase in complex with adp, 3pg and aluminium tetrafluoride (see paper)
41% identity, 98% coverage: 5:390/393 of query aligns to 6:402/405 of 2wzcA
2wzbA The catalytically active fully closed conformation of human phosphoglycerate kinase in complex with adp, 3pg and magnesium trifluoride (see paper)
41% identity, 98% coverage: 5:390/393 of query aligns to 6:402/405 of 2wzbA
1vjcA Structure of pig muscle pgk complexed with mgatp (see paper)
40% identity, 98% coverage: 5:390/393 of query aligns to 7:413/416 of 1vjcA
4axxA The catalytically active fully closed conformation of human phosphoglycerate kinase in complex with adp 3-phosphoglycerate and beryllium trifluoride
40% identity, 98% coverage: 5:390/393 of query aligns to 6:404/407 of 4axxA
>3608763 FitnessBrowser__Dino:3608763
MTWKTLDDMALDGKIVLTRVDINVPVADGVVTDTTRIERIVPTVTDILAKGGLPVLLAHF
GRPKGKVVPEMSLRVVLPALEEALGRPVEFIAHPDRAALEALPKCTVVLAENTRFAPGEE
KNDPEMAAALAALGDIYCNDAFSAAHRAHASTEGIARLLPSCAGRLMQAELEALQRALGT
PTRPVVAVVGGAKVSTKLALLGNLVEKVDDLVIGGGMANTFLAAQGIDVGASLAEHEMAD
TAREIMEKAARAGCSIHLPKDIVVARKFEAGAPSQTLPVSECPRDAMILDAGPETVAALK
EVFAQARTLIWNGPLGAFEIPPFDMATNAAARAAADATKAGTLITVAGGGDTVAALNKAG
VADDFTYISTAGGAFLEWMEGKTLPGVAALEAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory