Comparing 3608764 FitnessBrowser__Dino:3608764 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
Q9SJU4 Fructose-bisphosphate aldolase 1, chloroplastic; AtFBA1; EC 4.1.2.13 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
32% identity, 70% coverage: 10:214/294 of query aligns to 67:271/399 of Q9SJU4
Sites not aligning to the query:
Q944G9 Fructose-bisphosphate aldolase 2, chloroplastic; AtFBA2; EC 4.1.2.13 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 70% coverage: 10:214/294 of query aligns to 66:270/398 of Q944G9
Sites not aligning to the query:
Q9ZU52 Fructose-bisphosphate aldolase 3, chloroplastic; AtFBA3; Protein PIGMENT DEFECTIVE 345; EC 4.1.2.13 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 74% coverage: 10:227/294 of query aligns to 59:270/391 of Q9ZU52
Sites not aligning to the query:
2qdhA Fructose-1,6-bisphosphate aldolase from leishmania mexicana in complex with mannitol-1,6-bisphosphate, a competitive inhibitor (see paper)
30% identity, 75% coverage: 10:230/294 of query aligns to 36:252/366 of 2qdhA
Sites not aligning to the query:
2qdgA Fructose-1,6-bisphosphate schiff base intermediate in fbp aldolase from leishmania mexicana (see paper)
30% identity, 75% coverage: 10:230/294 of query aligns to 36:252/366 of 2qdgA
Sites not aligning to the query:
Q9SJQ9 Fructose-bisphosphate aldolase 6, cytosolic; AtFBA6; Cytosolic aldolase 2; cAld2; EC 4.1.2.13 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
26% identity, 82% coverage: 10:249/294 of query aligns to 23:278/358 of Q9SJQ9
6rngB Dipeptide gly-pro binds to a glycolytic enzyme fructose bisphosphate aldolase
26% identity, 82% coverage: 10:249/294 of query aligns to 18:273/334 of 6rngB
Sites not aligning to the query:
5tklA Crystal structure of fbp aldolase from toxoplasma gondii, condensation intermediate (see paper)
29% identity, 65% coverage: 10:200/294 of query aligns to 27:219/350 of 5tklA
Sites not aligning to the query:
P07764 Fructose-bisphosphate aldolase; EC 4.1.2.13 from Drosophila melanogaster (Fruit fly) (see 2 papers)
26% identity, 89% coverage: 10:272/294 of query aligns to 27:308/361 of P07764
Sites not aligning to the query:
>3608764 FitnessBrowser__Dino:3608764
MSKADQIRSGHGFIAALDQSGGSTPKALRLYGIEEDAYGTDAEMFDLIHQMRSRIVAAPA
FTGEKVIGAILFEMTMDREFAGKSAPAYLWEDKGVVPFLKIDKGLEAEANGVQLMKPMPG
LDDLLSRAAAMGIFGTKERSVISAANPKGIKAIVAQQFEIGAQVLAHGLVPILEPEVTIT
IADKAEAEDMLLAEILAHLDTVPEGLQIMLKLSLPSKPNQYLPLVEHAKVMKVVALSGGY
SREEANAKLAENTGVIASFSRALTEGLSAQQSDAEFNATIAATIDSIHAASIAG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory