Comparing 3608767 FitnessBrowser__Dino:3608767 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6cfoB Human pyruvate dehydrogenase e1 component complex with covalent tdp adduct acetyl phosphinate (see paper)
58% identity, 71% coverage: 128:447/451 of query aligns to 3:326/330 of 6cfoB
6cerD Human pyruvate dehydrogenase complex e1 component v138m mutation (see paper)
58% identity, 71% coverage: 128:447/451 of query aligns to 4:327/331 of 6cerD
P11177 Pyruvate dehydrogenase E1 component subunit beta, mitochondrial; PDHE1-B; EC 1.2.4.1 from Homo sapiens (Human) (see 6 papers)
58% identity, 71% coverage: 128:447/451 of query aligns to 32:355/359 of P11177
Sites not aligning to the query:
3dv0D Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex (see paper)
43% identity, 71% coverage: 128:448/451 of query aligns to 2:321/324 of 3dv0D
3dv0B Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex (see paper)
43% identity, 71% coverage: 128:448/451 of query aligns to 2:321/324 of 3dv0B
3dufD Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex (see paper)
43% identity, 71% coverage: 128:448/451 of query aligns to 2:321/324 of 3dufD
1w85B The crystal structure of pyruvate dehydrogenase e1 bound to the peripheral subunit binding domain of e2 (see paper)
43% identity, 71% coverage: 128:448/451 of query aligns to 2:321/324 of 1w85B
Q5SLR3 2-oxoisovalerate dehydrogenase subunit beta; Branched-chain alpha-keto acid dehydrogenase E1 component beta chain; BCKDH E1-beta; EC 1.2.4.4 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
43% identity, 71% coverage: 126:447/451 of query aligns to 1:320/324 of Q5SLR3
1umdD Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methyl-2-oxopentanoate as an intermediate (see paper)
43% identity, 71% coverage: 129:447/451 of query aligns to 3:319/323 of 1umdD
1umcD Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methylpentanoate (see paper)
43% identity, 71% coverage: 129:447/451 of query aligns to 3:319/323 of 1umcD
1umbD Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 in holo-form (see paper)
43% identity, 71% coverage: 129:447/451 of query aligns to 3:319/323 of 1umbD
1qs0B Crystal structure of pseudomonas putida 2-oxoisovalerate dehydrogenase (branched-chain alpha-keto acid dehydrogenase, e1b) (see paper)
37% identity, 67% coverage: 128:427/451 of query aligns to 4:316/338 of 1qs0B
1dtwB Human branched-chain alpha-keto acid dehydrogenase (see paper)
37% identity, 67% coverage: 125:426/451 of query aligns to 1:303/326 of 1dtwB
2j9fD Human branched-chain alpha-ketoacid dehydrogenase-decarboxylase e1b (see paper)
37% identity, 67% coverage: 125:426/451 of query aligns to 4:306/329 of 2j9fD
P21953 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial; Branched-chain alpha-keto acid dehydrogenase E1 component beta chain; BCKDE1B; BCKDH E1-beta; EC 1.2.4.4 from Homo sapiens (Human) (see 2 papers)
37% identity, 69% coverage: 117:426/451 of query aligns to 57:369/392 of P21953
G0S5Q0 Pyruvate dehydrogenase complex protein X component, mitochondrial; Dihydrolipoamide dehydrogenase-binding protein of pyruvate dehydrogenase complex; E3-binding protein; Pyruvate dehydrogenase complex component E3BP from Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) (Thermochaetoides thermophila) (see paper)
51% identity, 22% coverage: 2:99/451 of query aligns to 37:132/442 of G0S5Q0
Sites not aligning to the query:
O00330 Pyruvate dehydrogenase protein X component, mitochondrial; Dihydrolipoamide dehydrogenase-binding protein of pyruvate dehydrogenase complex; E3-binding protein; E3BP; Lipoyl-containing pyruvate dehydrogenase complex component X; proX from Homo sapiens (Human) (see 5 papers)
52% identity, 18% coverage: 4:82/451 of query aligns to 58:136/501 of O00330
Sites not aligning to the query:
6yakDDD C-terminal component of the split chain transketolase (see paper)
27% identity, 71% coverage: 129:447/451 of query aligns to 3:305/311 of 6yakDDD
A0A0D2Y5A7 Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial; FoDLAT; DLAT; EC 2.3.1.12 from Fusarium oxysporum f. sp. lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936) (Fusarium vascular wilt of tomato) (see paper)
52% identity, 18% coverage: 5:85/451 of query aligns to 39:119/457 of A0A0D2Y5A7
Sites not aligning to the query:
G0S4X6 Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial; Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; MRP3; Pyruvate dehydrogenase complex component E2; PDC-E2; PDCE2; EC 2.3.1.12 from Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) (Thermochaetoides thermophila) (see paper)
52% identity, 18% coverage: 3:81/451 of query aligns to 35:113/459 of G0S4X6
Sites not aligning to the query:
>3608767 FitnessBrowser__Dino:3608767
MATEILMPALSPTMEEGTLAKWFVKEGDSVSSGDILAEIETDKATMEFEAVDEGIIGKIL
VESGTDGVAVNTAIAVLIQDGETLSDTVAAAPSDEATDQQPAPAAPVTPARIVIPDEPDL
PPGTQMKSMTVREALRDAMAEEMRRNENVFLMGEEVAEYQGAYKISQGLLDEFGSKRVID
TPITEHGFAGLAVGAAFGGLNPIVEFMTFNFAMQAIDQIINSAAKTLYMSGGQMGCPIVF
RGPNGAAARVAAQHSQDSAAWYAHIPGLKVAMPYSASDAKGLLKSAIRDPNPVIFLENEI
LYGRSFEVPMIDDYTVPFGKARIWREGRDVTIVSFGIGMTYALEAADRLAKDGISAEVVD
LRTLRPLDTETVIASVQKTNRCVTVEEGFPVASIGNHISAVLMQEAFDYLDAPVINLTGK
DVPMPYAANLEKLALVTTDEVIEAVHKVTYR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory