Comparing 3608769 FitnessBrowser__Dino:3608769 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4hzdA Crystal structure of serine acetyltransferase in complex with coenzyme a from brucella abortus strain s19 (see paper)
55% identity, 92% coverage: 8:254/269 of query aligns to 3:249/250 of 4hzdA
6wyeA Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) (see paper)
55% identity, 95% coverage: 8:263/269 of query aligns to 4:258/261 of 6wyeA
1t3dA Crystal structure of serine acetyltransferase from e.Coli at 2.2a (see paper)
54% identity, 96% coverage: 7:263/269 of query aligns to 2:258/262 of 1t3dA
8i04A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with serine (see paper)
56% identity, 93% coverage: 14:263/269 of query aligns to 5:254/258 of 8i04A
7ra4A Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) in complex with serine (see paper)
57% identity, 88% coverage: 14:249/269 of query aligns to 8:243/243 of 7ra4A
3gvdI Crystal structure of serine acetyltransferase cyse from yersinia pestis
53% identity, 98% coverage: 7:269/269 of query aligns to 5:267/272 of 3gvdI
8i09A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with butyl gallate (see paper)
56% identity, 88% coverage: 14:251/269 of query aligns to 8:245/246 of 8i09A
4h7oA Crystal structure of serine acetyltransferase from vibrio cholerae o1 biovar el tor n16961
51% identity, 94% coverage: 14:266/269 of query aligns to 5:257/258 of 4h7oA
8i06A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with coa (see paper)
56% identity, 88% coverage: 14:249/269 of query aligns to 9:244/244 of 8i06A
1ssqD Serine acetyltransferase- complex with cysteine (see paper)
49% identity, 94% coverage: 14:265/269 of query aligns to 5:256/257 of 1ssqD
4n69A Soybean serine acetyltransferase complexed with serine (see paper)
53% identity, 88% coverage: 14:249/269 of query aligns to 8:243/243 of 4n69A
1sstA Serine acetyltransferase- complex with coa (see paper)
48% identity, 88% coverage: 14:249/269 of query aligns to 5:233/233 of 1sstA
4n6bA Soybean serine acetyltransferase complexed with coa (see paper)
52% identity, 88% coverage: 14:249/269 of query aligns to 4:233/233 of 4n6bA
7bw9A Crystal structure of serine acetyltransferase isoform 3 in complex with cysteine from entamoeba histolytica
38% identity, 64% coverage: 81:251/269 of query aligns to 98:270/280 of 7bw9A
3p47A Crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-cysteine (see paper)
40% identity, 58% coverage: 87:241/269 of query aligns to 106:268/270 of 3p47A
3q1xA Crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-serine (see paper)
40% identity, 58% coverage: 87:241/269 of query aligns to 104:266/267 of 3q1xA
1krvA Galactoside acetyltransferase in complex with coa and pnp-beta-gal (see paper)
33% identity, 43% coverage: 136:251/269 of query aligns to 62:183/201 of 1krvA
Sites not aligning to the query:
1kruA Galactoside acetyltransferase in complex with iptg and coenzyme a (see paper)
33% identity, 43% coverage: 136:251/269 of query aligns to 62:183/201 of 1kruA
Sites not aligning to the query:
1krrA Galactoside acetyltransferase in complex with acetyl-coenzyme a (see paper)
33% identity, 43% coverage: 136:251/269 of query aligns to 62:183/200 of 1krrA
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
33% identity, 43% coverage: 136:251/269 of query aligns to 63:184/203 of P07464
Sites not aligning to the query:
>3608769 FitnessBrowser__Dino:3608769
MGKASKSLKAVDPVWHRIGEEARLAVADEQLLGGLVHSSILHHATFEAALAYRITLKLSS
PEMSAQTLRQLVDDAFASDATLGVAARADLVAVYERDPACHRLMQPLLYFKGFQAVQAYR
VGHWLYSQGRHDLAYFVQMRVSEVFGVDIHPAAKIGQGIMIDHAHSIVIGETAVVGDNVS
MLHSVTLGGTGKEDDDRHPKIGDGVLIGAGAHVLGNITIGHCSRIAAGSVVLSDVPPCKT
VAGVPAKIVGEAGCAQPSVTMDQLLSESI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory