Comparing 3608829 Dshi_2221 ABC transporter related (RefSeq) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
56% identity, 99% coverage: 1:256/259 of query aligns to 2:256/258 of P02915
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
56% identity, 96% coverage: 9:256/259 of query aligns to 3:252/258 of 1b0uA
3c4jA Abc protein artp in complex with atp-gamma-s
51% identity, 95% coverage: 8:254/259 of query aligns to 3:239/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
51% identity, 95% coverage: 8:254/259 of query aligns to 3:239/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
51% identity, 95% coverage: 8:254/259 of query aligns to 3:239/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
51% identity, 95% coverage: 8:254/259 of query aligns to 3:239/242 of 2oljA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
50% identity, 95% coverage: 8:254/259 of query aligns to 1:237/240 of 4ymuJ
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
52% identity, 96% coverage: 7:254/259 of query aligns to 1:237/241 of 4u00A
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
38% identity, 94% coverage: 14:256/259 of query aligns to 11:244/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
37% identity, 94% coverage: 14:256/259 of query aligns to 12:245/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
37% identity, 94% coverage: 14:256/259 of query aligns to 12:245/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
37% identity, 94% coverage: 14:256/259 of query aligns to 12:245/344 of 6cvlD
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
38% identity, 90% coverage: 7:239/259 of query aligns to 3:228/648 of P75831
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
39% identity, 81% coverage: 8:216/259 of query aligns to 3:202/223 of 2pclA
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
38% identity, 82% coverage: 6:217/259 of query aligns to 1:207/615 of 5lilA
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
38% identity, 82% coverage: 6:217/259 of query aligns to 1:207/592 of 5lj7A
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
34% identity, 95% coverage: 13:257/259 of query aligns to 31:267/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
34% identity, 95% coverage: 13:257/259 of query aligns to 31:267/382 of 7aheC
Sites not aligning to the query:
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
34% identity, 84% coverage: 8:225/259 of query aligns to 3:215/226 of 5xu1B
1g291 Malk (see paper)
29% identity, 95% coverage: 9:255/259 of query aligns to 4:242/372 of 1g291
Sites not aligning to the query:
>3608829 Dshi_2221 ABC transporter related (RefSeq)
MTEPTVPVIEIRDLHKAYGALEVLKGVSIRAERGDVVSLIGSSGSGKSTLLRCCNLLEDS
QRGDVLFCGEPVTWTGSGLDRRPADKKQVIRIRTNLSMVFQQFNLWAHMTILENVMEAPV
TVLGEPPKEVEARARALLDKVGIGDKCDAYPAQLSGGQQQRAAIARGLAMEPKALLFDEP
TSALDPELEQEVVKVIKDLAAEGRTMLIVTHDMRLAADVSDHVVFLHQGLIEEEGPPDIL
FGQPKSARLKQFLSATAPA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory