SitesBLAST
Comparing 3608872 FitnessBrowser__Dino:3608872 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q46337 Sarcosine oxidase subunit alpha; Sarcosine oxidase subunit A; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit alpha; Tetrameric sarcosine oxidase subunit alpha; TSOX subunit alpha; EC 1.5.3.24 from Corynebacterium sp. (strain P-1) (see 2 papers)
38% identity, 99% coverage: 6:980/980 of query aligns to 16:967/967 of Q46337
- G139 (= G174) mutation to A: Does not affect activity and binding of NAD(+).
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
Q50LF0 Sarcosine oxidase subunit alpha; Sarcosine oxidase subunit A; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit alpha; Tetrameric sarcosine oxidase subunit alpha; TSOX subunit alpha; EC 1.5.3.24 from Corynebacterium sp. (strain U-96) (see 2 papers)
37% identity, 99% coverage: 9:980/980 of query aligns to 17:965/965 of Q50LF0
- A139 (= A176) binding
- D158 (≠ E195) binding
- E159 (= E196) binding
- R160 (≠ G197) binding
- T166 (≠ R203) binding
- V205 (= V241) binding
- A418 (= A440) binding
- L423 (≠ F445) binding
- T425 (= T447) binding
3ad7A Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with methylthio acetate (see paper)
37% identity, 99% coverage: 9:977/980 of query aligns to 16:961/963 of 3ad7A
- active site: L349 (= L377), L374 (= L396), D676 (= D695)
- binding flavin mononucleotide: K509 (= K528), R510 (= R529), T516 (≠ M535), Q520 (= Q539), T548 (= T566), R550 (= R568)
- binding nicotinamide-adenine-dinucleotide: G134 (= G172), G136 (= G174), P137 (= P175), A138 (= A176), D157 (≠ E195), E158 (= E196), R159 (≠ G197), T165 (≠ R203), V204 (= V241), T248 (≠ A284), A249 (≠ G285), S294 (≠ D330), F380 (≠ W402), G416 (= G439), L422 (≠ F445), D423 (≠ S446), T424 (= T447)
1vrqA Crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with folinic acid (see paper)
37% identity, 99% coverage: 9:977/980 of query aligns to 16:961/963 of 1vrqA
- active site: L349 (= L377), L374 (= L396), D676 (= D695)
- binding flavin mononucleotide: K509 (= K528), R510 (= R529), T516 (≠ M535), Q520 (= Q539), T548 (= T566), R550 (= R568)
- binding N-{[4-({[(6R)-2-amino-5-formyl-4-oxo-1,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)phenyl]carbonyl}-L-glutamic acid: L631 (= L650), Y663 (= Y682), G677 (= G696), H690 (≠ T709), I774 (= I791), F776 (= F793), E783 (= E800), K822 (= K839), F824 (= F841)
- binding nicotinamide-adenine-dinucleotide: G134 (= G172), G136 (= G174), P137 (= P175), A138 (= A176), D157 (≠ E195), E158 (= E196), R159 (≠ G197), T165 (≠ R203), V204 (= V241), T248 (≠ A284), A249 (≠ G285), S294 (≠ D330), F380 (≠ W402), G416 (= G439), L422 (≠ F445), D423 (≠ S446), T424 (= T447)
2gagA Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution (see paper)
37% identity, 99% coverage: 9:980/980 of query aligns to 17:965/965 of 2gagA
- active site: L350 (= L377), L375 (= L396), D677 (= D695)
- binding flavin mononucleotide: K510 (= K528), R511 (= R529), T517 (≠ M535), Q521 (= Q539), T549 (= T566), R551 (= R568)
- binding 2-furoic acid: N647 (≠ D665), G653 (≠ T671), T655 (≠ S673), K851 (= K866)
- binding nicotinamide-adenine-dinucleotide: V134 (≠ I171), G135 (= G172), G137 (= G174), P138 (= P175), A139 (= A176), D158 (≠ E195), E159 (= E196), R160 (≠ G197), G165 (= G202), T166 (≠ R203), T204 (= T240), V205 (= V241), T249 (≠ A284), G250 (= G285), S295 (≠ D330), F381 (≠ W402), G417 (= G439), A418 (= A440), L423 (≠ F445), D424 (≠ S446), T425 (= T447), Y554 (= Y571)
1worA Crystal structure of t-protein of the glycine cleavage system (see paper)
26% identity, 34% coverage: 604:941/980 of query aligns to 14:328/362 of 1worA
1wopA Crystal structure of t-protein of the glycine cleavage system (see paper)
26% identity, 34% coverage: 604:941/980 of query aligns to 14:328/362 of 1wopA
- active site: D96 (= D695)
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: M51 (≠ L650), L55 (≠ E654), Y83 (= Y682), D96 (= D695), V98 (≠ T697), E106 (≠ H705), L108 (≠ V707), V110 (≠ T712), N112 (≠ A714), I137 (≠ V740), E160 (≠ D763), Y168 (≠ F773), Y169 (≠ M774), K173 (≠ A778), S174 (≠ V779), I175 (≠ R780), E180 (≠ G785), T181 (≠ G786), Y188 (≠ F793), E195 (= E800), M197 (≠ A802), R227 (≠ L832), Y236 (≠ F841)
Sites not aligning to the query:
1wooA Crystal structure of t-protein of the glycine cleavage system (see paper)
26% identity, 34% coverage: 604:941/980 of query aligns to 14:328/362 of 1wooA
- active site: D96 (= D695)
- binding (6s)-5,6,7,8-tetrahydrofolate: M51 (≠ L650), Y83 (= Y682), D96 (= D695), V98 (≠ T697), V110 (≠ T712), N112 (≠ A714), Y168 (≠ F773), Y169 (≠ M774), Y188 (≠ F793), E195 (= E800), Y236 (≠ F841)
Sites not aligning to the query:
Q9UI17 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Homo sapiens (Human) (see 4 papers)
25% identity, 34% coverage: 613:950/980 of query aligns to 490:829/866 of Q9UI17
- A530 (≠ G643) to G: in dbSNP:rs1805073
- S646 (≠ D763) to P: in dbSNP:rs1805074
Sites not aligning to the query:
- 59:60 binding
- 80:81 binding
- 87:95 binding
- 91 modified: Tele-8alpha-FAD histidine
- 109 H → R: in DMGDHD; shows 10 fold lower catalytic efficiency due to lower cofactor saturation and reduced thermal stability; dbSNP:rs121908331
- 219 binding
- 279 S → P: in dbSNP:rs532964
- 397:402 binding
Q63342 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Rattus norvegicus (Rat) (see 2 papers)
26% identity, 27% coverage: 613:876/980 of query aligns to 483:755/857 of Q63342
Sites not aligning to the query:
- 52:53 binding
- 73:74 binding
- 80:88 binding
- 84 modified: Tele-8alpha-FAD histidine
- 212 binding
- 244 binding
- 390:395 binding
4pabB Crystal structure of the precursor form of rat dmgdh complexed with tetrahydrofolate (see paper)
25% identity, 34% coverage: 613:950/980 of query aligns to 446:785/824 of 4pabB
- active site: E536 (≠ D695)
- binding (6s)-5,6,7,8-tetrahydrofolate: I523 (≠ Y682), E536 (≠ D695), T538 (= T697), I550 (≠ T709), F612 (= F773), L613 (≠ M774), Y632 (≠ F793), E639 (= E800), F680 (= F841), Y700 (≠ R860)
Sites not aligning to the query:
- active site: 53, 102, 226, 255
- binding flavin-adenine dinucleotide: 11, 12, 14, 15, 16, 35, 36, 37, 43, 44, 45, 47, 48, 49, 50, 51, 175, 204, 205, 207, 226, 228, 326, 328, 353, 355, 356, 357, 358
1pj7A Structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folinic acid (see paper)
28% identity, 40% coverage: 592:980/980 of query aligns to 428:827/827 of 1pj7A
- active site: D549 (= D695)
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: L505 (= L650), Y536 (= Y682), D549 (= D695), T551 (= T697), G563 (vs. gap), F629 (≠ M774), Y648 (≠ F793), E655 (= E800), Y696 (≠ F841)
Sites not aligning to the query:
- active site: 222, 256
- binding flavin-adenine dinucleotide: 8, 10, 11, 12, 32, 33, 41, 42, 43, 45, 47, 49, 170, 171, 200, 201, 203, 222, 256, 331, 357, 358, 359, 360
1pj6A Crystal structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folic acid (see paper)
28% identity, 40% coverage: 592:980/980 of query aligns to 429:828/828 of 1pj6A
Sites not aligning to the query:
- active site: 223, 257
- binding flavin-adenine dinucleotide: 9, 11, 12, 13, 33, 34, 42, 43, 44, 46, 48, 50, 172, 201, 202, 204, 223, 257, 331, 332, 358, 359, 360, 361
Q9AGP8 Dimethylglycine oxidase; DMGO; EC 1.5.3.10 from Arthrobacter globiformis (see 2 papers)
28% identity, 40% coverage: 592:980/980 of query aligns to 431:830/830 of Q9AGP8
- Y539 (= Y682) binding
- D552 (= D695) Important for catalytic activity; mutation to A: No effect on the activity.; mutation to N: Reduces activity 3-fold.
Sites not aligning to the query:
- 14:15 binding
- 35:36 binding
- 45:48 binding
- 52 binding
- 174 binding
- 225 Important for catalytic activity; H→Q: Reduces catalytic efficiency 3-fold and substrate affinity 30-fold.
- 259 Important for catalytic activity; binding ; Y→F: Reduces catalytic efficiency 225-fold and substrate affinity 25-fold.
- 360:363 binding
3gsiA Crystal structure of d552a dimethylglycine oxidase mutant of arthrobacter globiformis in complex with tetrahydrofolate (see paper)
28% identity, 40% coverage: 592:980/980 of query aligns to 428:827/827 of 3gsiA
- active site: A549 (≠ D695)
- binding (6s)-5,6,7,8-tetrahydrofolate: L505 (= L650), Y536 (= Y682), T551 (= T697), G563 (vs. gap), F629 (≠ M774), Y648 (≠ F793), E655 (= E800), Y696 (≠ F841)
Sites not aligning to the query:
- active site: 222, 256
- binding flavin-adenine dinucleotide: 10, 11, 12, 32, 33, 41, 42, 43, 45, 47, 49, 170, 171, 200, 201, 203, 222, 256, 330, 331, 332, 357, 358, 359, 360
- binding magnesium ion: 254, 409
3a8iA Crystal structure of et-ehred-5-ch3-thf complex (see paper)
28% identity, 37% coverage: 604:970/980 of query aligns to 14:355/363 of 3a8iA
- active site: D97 (= D695)
- binding 5-methyl-5,6,7,8-tetrahydrofolic acid: M51 (≠ L650), Y84 (= Y682), D97 (= D695), I99 (≠ T697), V111 (≠ T709), N113 (≠ T711), F173 (= F773), Y188 (≠ F793), E195 (= E800), R223 (≠ L832), M232 (≠ F841), W252 (≠ R860)
Q8GAI3 4-methylaminobutanoate oxidase (formaldehyde-forming); MABO; Demethylating gamma-N-methylaminobutyrate oxidase; Gamma-N-methylaminobutyrate oxidase 1; EC 1.5.3.19 from Paenarthrobacter nicotinovorans (Arthrobacter nicotinovorans) (see paper)
24% identity, 38% coverage: 613:980/980 of query aligns to 464:824/824 of Q8GAI3
Sites not aligning to the query:
- 66 mutation W->F,S: Contains a non-covalently bound FAD. Loss of enzyme activity.
- 67 H→A: Contains a non-covalently bound FAD. Exhibits about 10% of the wild-type enzyme activity.
1wsvA Crystal structure of human t-protein of glycine cleavage system (see paper)
24% identity, 36% coverage: 601:952/980 of query aligns to 12:347/371 of 1wsvA
- active site: D98 (= D695)
- binding n-[4-({[(6s)-2-amino-4-hydroxy-5-methyl-5,6,7,8-tetrahydropteridin-6-yl]methyl}amino)benzoyl]-l-glutamic acid: M53 (≠ L650), L85 (≠ Y682), D98 (= D695), L99 (≠ G696), I100 (≠ T697), V112 (≠ T709), N114 (≠ T711), F173 (= F773), G193 (≠ S792), Y194 (≠ F793), E201 (= E800), R230 (≠ L832), L239 (≠ F841)
Sites not aligning to the query:
P48728 Aminomethyltransferase, mitochondrial; Glycine cleavage system T protein; GCVT; EC 2.1.2.10 from Homo sapiens (Human) (see 4 papers)
24% identity, 36% coverage: 601:952/980 of query aligns to 43:378/403 of P48728
- D129 (= D695) mutation D->A,N: Loss of aminomethyltransferase activity.
- N145 (≠ T711) to I: in GCE2; loss of aminomethyltransferase activity; dbSNP:rs386833682
- E232 (= E800) binding
- R261 (≠ L832) binding
- G269 (= G840) to D: in GCE2; decreased aminomethyltransferase activity; dbSNP:rs121964981
- R320 (≠ L887) to H: in GCE2; loss of aminomethyltransferase activity; dbSNP:rs121964985
Sites not aligning to the query:
3tfjA Dmsp-dependent demethylase from p. Ubique - with cofactor thf (see paper)
20% identity, 33% coverage: 637:955/980 of query aligns to 50:357/369 of 3tfjA
- active site: D108 (= D695)
- binding (6s)-5,6,7,8-tetrahydrofolate: E63 (≠ L650), Y95 (= Y682), D108 (= D695), V110 (≠ T697), S122 (≠ T712), I123 (≠ V713), A124 (= A714), F178 (≠ M774), W197 (≠ F793), E204 (= E800), Y265 (≠ M861)
Sites not aligning to the query:
Query Sequence
>3608872 FitnessBrowser__Dino:3608872
MRLDGAGLIDRDTPLRFQFDDRWMGGFAGDTLASALMANGVKLVARSFKYHRPRGIWSAG
SEEPNALVQVGKFARQVPNVRATQAELFEGLYATSQNRWPSLTLDLLSLNDLAAPFLGAG
FYYKTFMWPRSFWEKLYEPAIRRAAGLGALSGQTNTEPYEKAYAHCDLLVIGAGPAGLMA
ALTAARAGADVILAEEGDRCGGRLLSEQEEVDGASGQDWVSRIVAELVTSGRVRVMTRTT
VTGAYDGGIYGALERVGLHLADPAPALPRECFWRISARRAILCAGASERPIAFPMNDRPG
ILSAAALRTYANRYRTVPGPRVALFCNNDDAYRTARDLVASGVEVAAVVDTRAETPEGDY
PVFREARVVDTRGRHGLRRITVDGPDGRRQIEVDALGVSGGWNPNLHLTCHMYGRPTWNP
ALHAFVPTPGAVPGLDVAGAAAGVFSTHGALKSGVFRARKALESLELAPSSMPIPQADDA
PYVLSPIYAVDGAKGARGRAWLDFQNDVTVKDVRQAASENMTSVEHMKRYTTQGMATDQG
RVSNVLALSVLADATGRGIPETGTTTFRPPYTPVSLAALGAGAQGKGFAPERLTTSHAGS
LARGAPMVEAGLWYRPSYFPRDGETTWREACDREVGHVRSAVGVCDVSTLGKIELQGPDA
GAFLDLVYANTFSTLKPGRVRYGVMLREDGHVMDDGTTACLGPGHYVMTTTTVAAHKVMQ
HLEFVQQCLVPTMRVRFTSVTENWAQFAVAGPQARALLNDLLDAPVRNANFPFMACGAVR
LGGVGGRLFRISFSGEHAYEVAIPARYGAALFEQLVARAEAMGGGAYGMEALNVLRIEKG
FVTHAEIHGRVTADDVGLGRMVSAKKDCIGKTASQRPGLTDPDREQLVGLRPCDGRTALL
AGAHLFEPGAEAVRVTDQGYVTSVCFSPTLQTPIGLGFLRRGRARHGQRVMMIDHLRGVT
TECEVTDPVFFDPDGGRARG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory