SitesBLAST
Comparing 3608881 FitnessBrowser__Dino:3608881 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
Q5F8J4 NAD(+)-dependent homoserine dehydrogenase; NAD(+)-dependent HSD; NgHSD; EC 1.1.1.3 from Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) (see paper)
40% identity, 94% coverage: 28:428/428 of query aligns to 27:433/435 of Q5F8J4
- L45 (≠ R46) mutation to R: Shows a marked increase in the catalytic efficiency with NADP(+).
- LS 45:46 (≠ RS 46:47) mutation to RD: Does not impair the catalytic activity with NAD(+). Slightly increases the activity, but slightly decreases the affinity for NADP(+).; mutation to RR: Causes a shift in coenzyme preference from NAD(+) to NADP(+) by a factor of 974. Shows a slight decrease in the catalytic efficiency with NAD(+) and a 4.5-fold increase in catalytic efficiency with NADP(+).
6dzsA Mycobacterial homoserine dehydrogenase thra in complex with NADP
43% identity, 99% coverage: 4:426/428 of query aligns to 4:429/431 of 6dzsA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G11), L12 (= L12), G13 (= G13), N14 (≠ T14), V15 (= V15), V45 (≠ A45), R46 (= R46), R47 (≠ S47), R52 (= R52), I63 (≠ W61), L78 (= L80), M79 (= M81), P84 (= P87), A102 (= A105), K104 (= K107), G306 (= G304), T310 (= T308)
4pg7A Crystal structure of s. Aureus homoserine dehydrogenase at ph7.5 (see paper)
36% identity, 74% coverage: 5:320/428 of query aligns to 5:307/402 of 4pg7A
Sites not aligning to the query:
6a0sA Homoserine dehydrogenase from thermus thermophilus hb8 complexed with hse and NADPH (see paper)
37% identity, 74% coverage: 5:322/428 of query aligns to 4:308/331 of 6a0sA
- active site: D191 (= D203), K195 (= K207)
- binding l-homoserine: K99 (= K107), N150 (= N161), G151 (= G162), T152 (= T163), Y178 (= Y190), E180 (= E192), D186 (= D198), K195 (= K207)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (≠ L12), G12 (= G13), T13 (= T14), V14 (= V15), L42 (≠ S44), V43 (≠ A45), R44 (= R46), D45 (≠ S47), K48 (= K50), R50 (= R52), A73 (≠ L80), M74 (= M81), A97 (= A105), K99 (= K107), G177 (= G189), E180 (= E192), A289 (= A303), G290 (= G304), T294 (= T308)
2ejwA Homoserine dehydrogenase from thermus thermophilus hb8
37% identity, 74% coverage: 5:322/428 of query aligns to 4:308/331 of 2ejwA
6a0tB Homoserine dehydrogenase k99a mutant from thermus thermophilus hb8 complexed with hse and NADP+ (see paper)
37% identity, 74% coverage: 5:322/428 of query aligns to 4:308/332 of 6a0tB
- active site: D191 (= D203), K195 (= K207)
- binding l-homoserine: N150 (= N161), G151 (= G162), T152 (= T163), Y178 (= Y190), E180 (= E192), D186 (= D198), K195 (= K207)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G11), G11 (≠ L12), G12 (= G13), T13 (= T14), V14 (= V15), L42 (≠ S44), V43 (≠ A45), R44 (= R46), D45 (≠ S47), K48 (= K50), R50 (= R52), A73 (≠ L80), M74 (= M81), G75 (= G82), A97 (= A105), N98 (= N106), G177 (= G189), E180 (= E192), A289 (= A303), G290 (= G304), T294 (= T308)
4xb1A Hyperthermophilic archaeal homoserine dehydrogenase in complex with NADPH (see paper)
29% identity, 73% coverage: 5:317/428 of query aligns to 3:309/319 of 4xb1A
- active site: D211 (= D203), K215 (= K207)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: F8 (≠ A10), F10 (≠ L12), G11 (= G13), T12 (= T14), V13 (= V15), D39 (≠ A45), R40 (= R46), K57 (= K50), V91 (≠ L80), S92 (≠ M81), S93 (≠ G82), S114 (≠ A105), K116 (= K107), S141 (≠ A132), G295 (≠ A303), T300 (= T308)
4xb2A Hyperthermophilic archaeal homoserine dehydrogenase mutant in complex with NADPH (see paper)
30% identity, 73% coverage: 5:317/428 of query aligns to 3:309/319 of 4xb2A
- active site: D211 (= D203), K215 (= K207)
- binding l-homoserine: A171 (≠ G162), S172 (≠ T163), D206 (= D198), K215 (= K207)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: F8 (≠ A10), F10 (≠ L12), G11 (= G13), T12 (= T14), V13 (= V15), R40 (= R46), V91 (≠ L80), S92 (≠ M81), S93 (≠ G82), S114 (≠ A105), N115 (= N106), K116 (= K107), S141 (≠ A132), G295 (≠ A303), T300 (= T308)
7f4cA The crystal structure of the immature holo-enzyme of homoserine dehydrogenase complexed with NADP and 1,4-butandiol from the hyperthermophilic archaeon sulfurisphaera tokodaii. (see paper)
32% identity, 55% coverage: 87:321/428 of query aligns to 82:297/300 of 7f4cA
Sites not aligning to the query:
- binding nadp nicotinamide-adenine-dinucleotide phosphate: 6, 7, 8, 9, 10, 11, 37, 38, 39, 72, 73, 74
5x9dA Crystal structure of homoserine dehydrogenase in complex with l- cysteine and NAD (see paper)
32% identity, 55% coverage: 87:321/428 of query aligns to 82:299/302 of 5x9dA
- active site: D196 (= D203), K200 (= K207)
- binding (2R)-3-[[(4S)-3-aminocarbonyl-1-[(2R,3R,4S,5R)-5-[[[[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxymethyl]-3,4-bis(oxidanyl)oxolan-2-yl]-4H-pyridin-4-yl]sulfanyl]-2-azanyl-propanoic acid: P82 (= P87), T100 (≠ A105), N101 (= N106), K102 (= K107), G127 (≠ A132), S131 (≠ G136), N155 (= N161), G156 (= G162), T157 (= T163), Y183 (= Y190), A184 (≠ L191), E185 (= E192), D191 (= D198), D196 (= D203), K200 (= K207), A281 (= A303), G282 (= G304), A286 (≠ T308)
Sites not aligning to the query:
- binding (2R)-3-[[(4S)-3-aminocarbonyl-1-[(2R,3R,4S,5R)-5-[[[[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxymethyl]-3,4-bis(oxidanyl)oxolan-2-yl]-4H-pyridin-4-yl]sulfanyl]-2-azanyl-propanoic acid: 6, 7, 8, 9, 10, 11, 37, 38, 72, 73, 74
3ingA Crystal structure of homoserine dehydrogenase (np_394635.1) from thermoplasma acidophilum at 1.95 a resolution
29% identity, 53% coverage: 5:232/428 of query aligns to 3:238/319 of 3ingA
- active site: D209 (= D203), K213 (= K207)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G11), T10 (≠ L12), G11 (= G13), N12 (≠ T14), V13 (= V15), D38 (vs. gap), S39 (≠ A45), K57 (≠ N63), C85 (≠ L80), T86 (≠ M81), P87 (≠ G82), A112 (= A105), N113 (= N106), K114 (= K107), A139 (= A132), E198 (= E192), S199 (≠ A193)
Sites not aligning to the query:
3jsaA Homoserine dehydrogenase from thermoplasma volcanium complexed with NAD
30% identity, 53% coverage: 5:230/428 of query aligns to 4:239/321 of 3jsaA
- active site: D212 (= D203), K216 (= K207)
- binding nicotinamide-adenine-dinucleotide: G10 (= G11), L11 (= L12), G12 (= G13), N13 (≠ T14), V14 (= V15), D42 (vs. gap), S43 (= S44), A90 (≠ L80), T91 (≠ M81), P92 (vs. gap), A117 (= A105), N118 (= N106), A144 (= A132)
Sites not aligning to the query:
O94671 Probable homoserine dehydrogenase; HDH; EC 1.1.1.3 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
26% identity, 49% coverage: 5:215/428 of query aligns to 8:239/376 of O94671
- S201 (≠ L181) modified: Phosphoserine
O81852 Bifunctional aspartokinase/homoserine dehydrogenase 2, chloroplastic; AK-HD 2; AK-HSDH 2; Beta-aspartyl phosphate homoserine 2; EC 2.7.2.4; EC 1.1.1.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
24% identity, 77% coverage: 5:332/428 of query aligns to 558:916/916 of O81852
Sites not aligning to the query:
- 441 I→A: Loss of threonine sensitivity for the aspartokinase activity and decreased inhibition of homoserine dehydrogenase activity by threonine.
- 443 Q→A: Loss of threonine sensitivity for the aspartokinase activity and decreased inhibition of homoserine dehydrogenase activity by threonine.
- 522 I→A: No effect on the inhibition of aspartokinase activity by threonine, but decreased inhibition of homoserine dehydrogenase activity by threonine.
- 524 Q→A: No effect on the inhibition of aspartokinase activity by threonine, but decreased inhibition of homoserine dehydrogenase activity by threonine.
1tveA Homoserine dehydrogenase in complex with 4-(4-hydroxy-3- isopropylphenylthio)-2-isopropylphenol (see paper)
32% identity, 24% coverage: 128:229/428 of query aligns to 139:236/358 of 1tveA
Sites not aligning to the query:
1q7gA Homoserine dehydrogenase in complex with suicide inhibitor complex NAD-5-hydroxy-4-oxonorvaline (see paper)
32% identity, 24% coverage: 128:229/428 of query aligns to 139:236/358 of 1q7gA
Sites not aligning to the query:
- binding nicotinamide-adenine-dinucleotide-5-hydroxy-4-oxonorvaline: 13, 14, 15, 39, 91, 92, 93, 97, 114, 116, 338, 343
1ebuD Homoserine dehydrogenase complex with NAD analogue and l-homoserine (see paper)
32% identity, 24% coverage: 128:229/428 of query aligns to 139:236/358 of 1ebuD
Sites not aligning to the query:
- binding 3-aminomethyl-pyridinium-adenine-dinucleotide: 11, 12, 13, 14, 15, 39, 40, 91, 93, 116, 343
1ebfA Homoserine dehydrogenase from s. Cerevisiae complex with NAD+ (see paper)
32% identity, 24% coverage: 128:229/428 of query aligns to 139:236/358 of 1ebfA
Sites not aligning to the query:
P31116 Homoserine dehydrogenase; HDH; EC 1.1.1.3 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
32% identity, 24% coverage: 128:229/428 of query aligns to 140:237/359 of P31116
- E208 (= E192) binding ; mutation to D: Increases KM for aspartate-semialdehyde 48-fold and reduces kcat by 50%.; mutation E->L,Q: Loss of activity.
- D219 (= D203) mutation to L: Reduces kcat 150-fold.
- K223 (= K207) mutation to V: Loss of activity.
Sites not aligning to the query:
- 11:18 binding
- 93 binding
- 117 binding
Query Sequence
>3608881 FitnessBrowser__Dino:3608881
MSSPLRLGIAGLGTVGAGVVKIISRKQELLAARAGRPIEVTAVSARSRDKDRGVDMSTYG
WENDPVALARRDDVDVFVELMGGEDGPARNATEAALAAGKDVVTANKAMLAHHGQALAMA
AEDAGRVIRFEAAVAGGIPVIKALTEGLAGNEITRVMGVMNGTCNYILTRMEAEGLGYNI
LFEEAGKLGYLEADPTLDVGGIDAAHKLALLASIAFGTKVDFDGVELEGIEQVTLEDIRH
AADMGFRIKLLGVAQRSGRGLEQRMRPCLVPASSPLGQLEGGTNMVVIEGDQVGQVVLRG
AGAGEGPTASAVLSDIMDIARGDRISTFGQPASGLVTPIRAQSAVAAPYYLRMELEDKPG
ALAKVATVLGDSGVSIDRMRQYGHESSSAPVLIVTHKAARNAVDAALEALPKTGVVLGTP
VALRIEAV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory