SitesBLAST
Comparing 3608903 FitnessBrowser__Dino:3608903 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1kb0A Crystal structure of quinohemoprotein alcohol dehydrogenase from comamonas testosteroni (see paper)
27% identity, 79% coverage: 143:749/769 of query aligns to 20:540/670 of 1kb0A
- active site: E185 (≠ V334), N263 (= N398), D308 (= D442)
- binding calcium ion: E185 (≠ V334), N263 (= N398), D308 (= D442)
- binding pyrroloquinoline quinone: E70 (≠ Q197), C116 (= C242), C117 (vs. gap), R122 (= R243), T167 (= T312), G182 (= G331), G183 (≠ M332), A184 (= A333), E185 (≠ V334), T243 (≠ N378), W245 (= W380), D308 (= D442), K335 (= K470), N394 (= N570), W395 (= W571), W479 (≠ F672)
- binding tetrahydrofuran-2-carboxylic acid: C116 (= C242), C117 (vs. gap), E185 (≠ V334), D308 (= D442), P389 (≠ Y565)
Sites not aligning to the query:
- binding heme c: 598, 599, 602, 603, 617, 620, 631, 637, 640, 642, 643, 645
- binding pyrroloquinoline quinone: 543, 544
Q46444 Quinohemoprotein alcohol dehydrogenase; QH-ADH; Alcohol dehydrogenase (azurin); PQQ-containing alcohol dehydrogenase; PQQ-dependent ADH; Quinohaemoprotein ethanol dehydrogenase type I; QH-EDHI; EC 1.1.9.1 from Comamonas testosteroni (Pseudomonas testosteroni) (see 3 papers)
27% identity, 79% coverage: 143:749/769 of query aligns to 51:571/708 of Q46444
- E101 (≠ Q197) binding
- C147 (= C242) modified: Disulfide link with 148
- C148 (vs. gap) modified: Disulfide link with 147
- R153 (= R243) binding
- T198 (= T312) binding
- GA 214:215 (≠ MA 332:333) binding
- E216 (≠ V334) binding
- T274 (≠ N378) binding
- N294 (= N398) binding
- D339 (= D442) binding
- K366 (= K470) binding
- NW 425:426 (= NW 570:571) binding
Sites not aligning to the query:
- 1:31 signal peptide
- 575 binding
- 635 binding covalent
- 638 binding covalent
- 639 binding axial binding residue
- 678 binding axial binding residue
Q4W6G0 Quinohemoprotein alcohol dehydrogenase ADH-IIG; ADH IIG; Alcohol dehydrogenase (azurin); EC 1.1.9.1 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
26% identity, 84% coverage: 106:749/769 of query aligns to 2:567/718 of Q4W6G0
- C138 (≠ Y247) modified: Disulfide link with 139
- C139 (≠ Y248) modified: Disulfide link with 138
- R144 (= R253) binding
- T189 (= T312) binding
- GA 205:206 (≠ MA 332:333) binding
- E207 (≠ V334) binding
- T264 (≠ N378) binding
- N284 (= N398) binding
- D329 (= D442) binding
- K356 (= K470) binding
- W415 (≠ F566) binding
- DW 419:420 (≠ NW 570:571) binding
Sites not aligning to the query:
- 1:29 signal peptide
- 30:718 modified: mature protein, Quinohemoprotein alcohol dehydrogenase ADH-IIG
- 635 binding covalent
- 638 binding covalent
- 639 binding axial binding residue
- 676 binding axial binding residue
1kv9A Structure at 1.9 a resolution of a quinohemoprotein alcohol dehydrogenase from pseudomonas putida hk5 (see paper)
26% identity, 80% coverage: 135:749/769 of query aligns to 1:521/664 of 1kv9A
- active site: E173 (≠ V334), N250 (= N398), D295 (= D442)
- binding acetone: E173 (≠ V334), D295 (= D442)
- binding calcium ion: E173 (≠ V334), N250 (= N398), D295 (= D442)
- binding heme c: A101 (≠ G244), R102 (≠ V245)
- binding pyrroloquinoline quinone: E59 (≠ Q197), C105 (≠ Y248), C106 (≠ E249), R111 (≠ E254), T155 (= T312), G170 (= G331), A172 (= A333), E173 (≠ V334), T230 (≠ N378), W232 (= W380), K322 (= K470), N382 (= N570), W383 (= W571), W460 (≠ L686)
Sites not aligning to the query:
- binding heme c: 590, 591, 594, 595, 605, 606, 608, 611, 615, 619, 623, 631, 633, 636
- binding pyrroloquinoline quinone: 525
1yiqA Molecular cloning and structural analysis of quinohemoprotein alcohol dehydrogenase adhiig from pseudomonas putida hk5. Compariison to the other quinohemoprotein alcohol dehydrogenase adhiib found in the same microorganism. (see paper)
26% identity, 80% coverage: 132:749/769 of query aligns to 2:538/684 of 1yiqA
- active site: E178 (≠ V334), N255 (= N398), D300 (= D442)
- binding calcium ion: E178 (≠ V334), N255 (= N398), D300 (= D442)
- binding pyrroloquinoline quinone: E63 (≠ Q197), C109 (≠ Y247), C110 (≠ Y248), R115 (= R253), T160 (= T312), G175 (= G331), G176 (≠ M332), A177 (= A333), E178 (≠ V334), T235 (≠ N378), W237 (= W380), K327 (= K470), D390 (≠ N570), W391 (= W571), F477 (≠ L686)
Sites not aligning to the query:
- binding heme c: 605, 606, 608, 609, 610, 623, 626, 630, 634, 637, 638, 642, 645, 646, 647, 648, 650
- binding pyrroloquinoline quinone: 542
Q8GR64 Quinohemoprotein alcohol dehydrogenase ADH IIB; ADH IIB; Alcohol dehydrogenase (azurin); EC 1.1.9.1 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 3 papers)
26% identity, 80% coverage: 138:749/769 of query aligns to 26:543/690 of Q8GR64
- E81 (≠ Q197) binding
- C127 (≠ Y248) modified: Disulfide link with 128
- C128 (≠ E249) modified: Disulfide link with 127
- R133 (≠ E254) binding
- T177 (= T312) binding
- GA 193:194 (≠ MA 332:333) binding
- E195 (≠ V334) binding
- T252 (≠ N378) binding
- N272 (= N398) binding
- D317 (= D442) binding
- K344 (= K470) binding
- NW 404:405 (= NW 570:571) binding
Sites not aligning to the query:
- 1:22 signal peptide
- 23:690 modified: mature protein, Quinohemoprotein alcohol dehydrogenase ADH IIB
- 547 binding
- 613 binding covalent
- 616 binding covalent
- 617 binding axial binding residue
- 655 binding axial binding residue
O05542 Alcohol dehydrogenase (quinone), dehydrogenase subunit; ADH; Alcohol dehydrogenase (quinone), acceptor subunit; Alcohol dehydrogenase (quinone), subunit I; Ethanol:Q2 reductase; G3-ADH subunit I; Quinohemoprotein alcohol dehydrogenase; Quinohemoprotein-cytochrome c complex; Ubiquinol oxidase; EC 1.1.5.5 from Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans) (see paper)
30% identity, 44% coverage: 151:485/769 of query aligns to 53:384/757 of O05542
Sites not aligning to the query:
- 1:34 signal peptide
- 35 modified: Pyrrolidone carboxylic acid
8gy2A Cryo-em structure of membrane-bound alcohol dehydrogenase from gluconobacter oxydans
30% identity, 44% coverage: 151:485/769 of query aligns to 19:350/723 of 8gy2A
- binding calcium ion: E181 (≠ V334), N263 (= N398), D308 (= D442)
- binding heme c: D104 (≠ Q240)
- binding pyrroloquinoline quinone: C107 (vs. gap), C108 (vs. gap), D163 (≠ T312), G179 (≠ M332), A180 (= A333), E181 (≠ V334), W245 (= W380), N263 (= N398), D308 (= D442), K335 (= K470)
Sites not aligning to the query:
- binding heme c: 618, 619, 622, 623, 633, 634, 636, 639, 652, 660, 662, 665
- binding pyrroloquinoline quinone: 398, 489
6zcvA Crystal structure of lanthanide-dependent alcohol dehydrogenase pedh from pseudomonas putida kt2440
24% identity, 77% coverage: 161:749/769 of query aligns to 26:526/562 of 6zcvA
- active site: E172 (= E336), N254 (= N398), D296 (= D442)
- binding calcium ion: N161 (≠ G319), K163 (≠ R321), P278 (≠ V424), D279 (≠ E425)
- binding pyrroloquinoline quinone: Q60 (= Q195), C104 (≠ R241), C105 (= C242), I108 (vs. gap), R110 (= R243), S154 (≠ T312), G170 (≠ V334), G171 (≠ D335), E172 (= E336), W236 (vs. gap), D298 (= D444), R323 (≠ K470), N390 (= N570), W466 (≠ V687)
Sites not aligning to the query:
7o6zB Structure of a neodymium-containing, xoxf1-type methanol dehydrogenase (see paper)
30% identity, 44% coverage: 148:485/769 of query aligns to 9:356/588 of 7o6zB
- binding methanol: E173 (= E336), W263 (≠ Y404), D314 (= D442)
- binding Neodymium Ion: E173 (= E336), N259 (= N398), D314 (= D442), D316 (= D444)
- binding pyrroloquinoline quinone: E55 (≠ T193), C105 (≠ Y247), C106 (≠ Y248), R111 (= R253), T155 (= T312), G170 (≠ A333), G171 (≠ V334), D172 (= D335), E173 (= E336), W241 (= W380), D316 (= D444), R341 (≠ K470)
Sites not aligning to the query:
7o6zA Structure of a neodymium-containing, xoxf1-type methanol dehydrogenase (see paper)
30% identity, 44% coverage: 148:485/769 of query aligns to 9:356/588 of 7o6zA
Sites not aligning to the query:
6damA Crystal structure of lanthanide-dependent methanol dehydrogenase xoxf from methylomicrobium buryatense 5g (see paper)
28% identity, 45% coverage: 151:493/769 of query aligns to 13:352/563 of 6damA
- active site: E171 (= E336), N259 (= N398), D301 (= D442)
- binding pyrroloquinoline quinone: E55 (≠ T193), C103 (≠ Y247), C104 (≠ Y248), R109 (= R253), T153 (= T312), S168 (≠ A333), G169 (≠ V334), G170 (≠ D335), E171 (= E336), T239 (≠ N378), W241 (= W380), D303 (= D444), R328 (≠ K470)
Sites not aligning to the query:
4maeA Methanol dehydrogenase from methylacidiphilum fumariolicum solv (see paper)
28% identity, 44% coverage: 145:485/769 of query aligns to 7:341/577 of 4maeA
- active site: E172 (= E336), N256 (= N398), D299 (= D442)
- binding cerium (iii) ion: E172 (= E336), N256 (= N398), D299 (= D442), D301 (= D444)
- binding pyrroloquinoline quinone: E55 (≠ T193), C104 (≠ Y247), C105 (≠ Y248), R110 (= R253), T154 (= T312), S169 (≠ A333), G170 (≠ V334), G171 (≠ D335), E172 (= E336), T236 (≠ N378), W238 (= W380), D301 (= D444), R326 (≠ K470)
Sites not aligning to the query:
6fkwA Europium-containing methanol dehydrogenase (see paper)
28% identity, 44% coverage: 145:485/769 of query aligns to 7:341/576 of 6fkwA
- active site: E172 (= E336), N256 (= N398), D299 (= D442), D301 (= D444)
- binding europium ion: E172 (= E336), N256 (= N398), D299 (= D442), D301 (= D444)
- binding pyrroloquinoline quinone: E55 (≠ T193), C104 (≠ Y247), C105 (≠ Y248), R110 (= R253), T154 (= T312), S169 (≠ A333), G170 (≠ V334), G171 (≠ D335), E172 (= E336), T236 (≠ N378), W238 (= W380), D301 (= D444), R326 (≠ K470)
Sites not aligning to the query:
2d0vA Crystal structure of methanol dehydrogenase from hyphomicrobium denitrificans (see paper)
26% identity, 44% coverage: 145:486/769 of query aligns to 7:347/597 of 2d0vA
- active site: E177 (≠ V334), N261 (= N398), D303 (= D442)
- binding calcium ion: E177 (≠ V334), N261 (= N398), D303 (= D442)
- binding pyrroloquinoline quinone: E55 (≠ T193), R109 (= R253), T159 (= T312), S174 (≠ G331), G175 (≠ M332), A176 (= A333), E177 (≠ V334), T241 (≠ N378), W243 (= W380), R331 (≠ K470)
Sites not aligning to the query:
P16027 Methanol dehydrogenase [cytochrome c] subunit 1; MDH large subunit alpha; MEDH; EC 1.1.2.7 from Methylorubrum extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1) (Methylobacterium extorquens) (see 3 papers)
26% identity, 45% coverage: 145:489/769 of query aligns to 34:377/626 of P16027
- C130 (≠ Y247) modified: Disulfide link with 131; mutation to S: Inactive.
- C131 (≠ Y248) modified: Disulfide link with 130; mutation to S: Inactive.
- D330 (= D442) mutation to E: Lower affinity for methanol.
Sites not aligning to the query:
- 1:27 signal peptide
- 413 modified: Disulfide link with 442
- 442 modified: Disulfide link with 413
1w6sC The high resolution structure of methanol dehydrogenase from methylobacterium extorquens (see paper)
26% identity, 45% coverage: 145:489/769 of query aligns to 7:350/596 of 1w6sC
- active site: E177 (≠ V334), N261 (= N398), D303 (= D442)
- binding calcium ion: E177 (≠ V334), N261 (= N398)
- binding pyrroloquinoline quinone: E55 (≠ T193), C103 (≠ Y247), C104 (≠ Y248), R109 (= R253), T159 (= T312), S174 (≠ G331), A176 (= A333), E177 (≠ V334), T241 (≠ N378), W243 (= W380), R331 (≠ K470)
Sites not aligning to the query:
5xm3A Crystal structure of methanol dehydrogenase from methylophaga aminisulfidivorans (see paper)
26% identity, 44% coverage: 145:486/769 of query aligns to 7:347/596 of 5xm3A
- active site: E177 (≠ V334), N261 (= N398), D303 (= D442)
- binding magnesium ion: E177 (≠ V334), N261 (= N398)
- binding pyrroloquinoline quinone: E55 (≠ T193), C103 (≠ Y247), R109 (= R253), T159 (= T312), S174 (≠ G331), G175 (≠ M332), A176 (= A333), E177 (≠ V334), T241 (≠ N378), W243 (= W380), R331 (≠ K470)
Sites not aligning to the query:
4mh1B Crystal structure and functional studies of quinoprotein l-sorbose dehydrogenase from ketogulonicigenium vulgare y25 (see paper)
24% identity, 80% coverage: 152:768/769 of query aligns to 20:514/514 of 4mh1B
- active site: D240 (= D442)
- binding pyrroloquinoline quinone: Q60 (= Q197), F106 (≠ R243), R111 (≠ E254), S154 (≠ T312), T169 (≠ P337), W196 (= W380), E242 (≠ P449), K284 (≠ T523), W346 (vs. gap), Y421 (≠ V687), Y485 (vs. gap)
6oc6A Lanthanide-dependent methanol dehydrogenase xoxf from methylobacterium extorquens, in complex with lanthanum and pyrroloquinoline quinone (see paper)
28% identity, 43% coverage: 162:493/769 of query aligns to 24:347/579 of 6oc6A
- active site: E171 (≠ W327), N255 (= N398), D297 (= D442)
- binding pyrroloquinoline quinone: E55 (≠ T193), C103 (≠ Y247), C104 (≠ Y248), R109 (= R253), T153 (≠ P306), S168 (≠ L324), G169 (= G325), G170 (= G326), E171 (≠ W327), W237 (= W380), D299 (= D444), R324 (≠ K470)
Sites not aligning to the query:
Query Sequence
>3608903 FitnessBrowser__Dino:3608903
MTKLFGAILVLVGALMFVPGIWLIALGGSWYYSLAGAGLAAAGFYYWKKQLLGAWIFGAV
FAGTALWAVWEVGFELWPLVPRLVAPMVLAILAVLLVPSLNEGRGRTASLAAAGVLALGI
AGFFWGMATPQNVIANTDPVPTRAIAAESPNWTHYGRTPTGTRFAPFDQITPENVGELEV
AWTFNHGDAPSGTGQDQNTPLYVDGLVYHCSPNNIVSAIDAVTGAQVWQYDPEASSPLWQ
RCRGVTYYEPTPREGAPADGTCAARIVLSSVDARLIQLDARTGALCTTFGDGGAVDLTRN
MGEVRPGFYFPTSAPTVMGDRIILGGWVWDGMAVDEPSGVVRAFDGRTGEIAWAWDIGNP
AIDTVPPEGETYTRGTPNVWSTPAFDAALGLVYLPTGNAQPDFYGSSRIEAANDWNSSIV
ALDVETGKVVWSFQTTYRDIWDYDVPAQPMLYDITTETGEVVPALIQVTKRSQTFVLDRR
DGTPIAEVRDLPVPTTGGVEPDYLSPVQPYSVDMPVIGAEPLTEARMWGATPLDHLYCRI
RFRQAYYVGDFTPMSEQGTLIWPGYFGGMNWGTGTIDEARGLLIVNDTRVAHLLQLIPRQ
EADALGVEVVGPHDGLAPQDGAPFGAMRSNFFSFVGVPCQEPPYGTMTAIDLADRSILWQ
RPVGTIEETGPFGIRTGWRMPVGLPLVGGPISTASGLTFYSGTQDYYLRAFSSETGEELW
RGALPLGSQSTPMSYIGPDGRQYVVVTVGGLNDIMGRGDIVMAFALPEE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory