Comparing 3608907 Dshi_2298 alanine racemase domain protein (RefSeq) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
1sftA Alanine racemase (see paper)
34% identity, 42% coverage: 7:162/373 of query aligns to 10:167/382 of 1sftA
Sites not aligning to the query:
1ftxA Crystal structure of alanine racemase in complex with d-alanine phosphonate
34% identity, 42% coverage: 7:162/373 of query aligns to 10:167/380 of 1ftxA
Sites not aligning to the query:
1bd0A Alanine racemase complexed with alanine phosphonate (see paper)
34% identity, 42% coverage: 7:162/373 of query aligns to 10:167/381 of 1bd0A
Sites not aligning to the query:
1l6gA Alanine racemase bound with n-(5'-phosphopyridoxyl)-d-alanine (see paper)
34% identity, 42% coverage: 7:162/373 of query aligns to 10:167/382 of 1l6gA
Sites not aligning to the query:
1l6fA Alanine racemase bound with n-(5'-phosphopyridoxyl)-l-alanine (see paper)
34% identity, 42% coverage: 7:162/373 of query aligns to 10:167/382 of 1l6fA
Sites not aligning to the query:
1epvA Alanine racemase with bound inhibitor derived from d- cycloserine (see paper)
34% identity, 42% coverage: 7:162/373 of query aligns to 10:167/382 of 1epvA
Sites not aligning to the query:
1xqlA Effect of a y265f mutant on the transamination based cycloserine inactivation of alanine racemase (see paper)
34% identity, 42% coverage: 7:162/373 of query aligns to 10:167/382 of 1xqlA
Sites not aligning to the query:
1xqkA Effect of a y265f mutant on the transamination based cycloserine inactivation of alanine racemase (see paper)
34% identity, 42% coverage: 7:162/373 of query aligns to 10:167/382 of 1xqkA
Sites not aligning to the query:
P10724 Alanine racemase; EC 5.1.1.1 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see 8 papers)
34% identity, 42% coverage: 7:162/373 of query aligns to 11:168/388 of P10724
Sites not aligning to the query:
>3608907 Dshi_2298 alanine racemase domain protein (RefSeq)
MKNPRLEVDLCKIRHNAQTLAGRLTPRGLGITAVTKAVCGNPAIARAMLEGGAVGLAEAR
LRNVRRLREAGLTCAVTLIRTPMLSEAAEVVRLCETSFNSDLRVISALSAESCPRRAAHG
IILMVEMGDLREGILPEELGALALRVRALPGVVLQGIGANFACFGGQAPEPAIMMALSDI
VVETERTCGVILQTVSGGNSANLPWAMGATPTGRITDLRLGEAILLGVEPVSGDRIAGLH
TDAITLVAEVIEAGFKSLPSRAAKATASGRRIRPSRTTRLILALGVQDTDVQGLVMPVGT
TFVGATSDHLVVVTQNALPRPGGEMRFQLNYSALMRAMAAPDIETVLRCDRPPTDASYAV
ADPVLAQHRHHQY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory