SitesBLAST
Comparing 3608919 FitnessBrowser__Dino:3608919 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q88H32 Ornithine cyclodeaminase; OCD; EC 4.3.1.12 from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) (see paper)
54% identity, 92% coverage: 20:348/357 of query aligns to 4:334/350 of Q88H32
1x7dA Crystal structure analysis of ornithine cyclodeaminase complexed with NAD and ornithine to 1.6 angstroms (see paper)
54% identity, 92% coverage: 20:348/357 of query aligns to 3:333/340 of 1x7dA
- active site: E55 (= E72), D227 (= D243)
- binding nicotinamide-adenine-dinucleotide: T83 (= T100), R111 (= R128), T112 (= T129), G137 (= G154), A138 (= A155), Q139 (= Q156), D160 (= D177), T161 (≠ I178), V200 (≠ C216), T201 (= T217), A202 (= A218), I209 (= I225), V224 (≠ I240), G225 (= G241), D227 (= D243), K231 (= K247), S292 (≠ G308), V293 (= V309), G294 (= G310)
- binding L-ornithine: R44 (= R61), V53 (= V70), E55 (= E72), M57 (= M74), K68 (= K85), V70 (= V87), N71 (= N88), G72 (= G89), R111 (= R128), D227 (= D243), V293 (= V309)
1u7hA Structure and a proposed mechanism for ornithine cyclodeaminase from pseudomonas putida (see paper)
54% identity, 92% coverage: 20:348/357 of query aligns to 3:333/341 of 1u7hA
- active site: E55 (= E72), D227 (= D243)
- binding nicotinamide-adenine-dinucleotide: T83 (= T100), R111 (= R128), T112 (= T129), G137 (= G154), A138 (= A155), Q139 (= Q156), D160 (= D177), T161 (≠ I178), V200 (≠ C216), T201 (= T217), A202 (= A218), I209 (= I225), V224 (≠ I240), G225 (= G241), D227 (= D243), K231 (= K247), S292 (≠ G308), V293 (= V309), G294 (= G310)
O28608 Alanine dehydrogenase; AlaDH; EC 1.4.1.1 from Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) (see paper)
32% identity, 78% coverage: 46:324/357 of query aligns to 24:306/322 of O28608
1omoA Alanine dehydrogenase dimer w/bound NAD (archaeal) (see paper)
32% identity, 78% coverage: 46:324/357 of query aligns to 24:306/320 of 1omoA
- active site: R52 (≠ E72), D219 (= D243)
- binding nicotinamide-adenine-dinucleotide: T109 (= T129), G134 (= G154), T135 (≠ A155), Q136 (= Q156), Y156 (= Y176), D157 (= D177), V158 (≠ I178), R159 (≠ D179), T195 (= T217), P196 (≠ A218), G217 (= G241), D219 (= D243), K223 (= K247), S290 (≠ G308), T291 (≠ V309), G292 (= G310)
6t3eB Structure of thermococcus litoralis delta(1)-pyrroline-2-carboxylate reductase in complex with nadh and l-proline (see paper)
29% identity, 75% coverage: 69:337/357 of query aligns to 49:325/325 of 6t3eB
- binding 1,4-dihydronicotinamide adenine dinucleotide: S82 (≠ T100), T111 (= T129), G136 (= G154), V137 (≠ A155), Q138 (= Q156), D159 (= D177), I160 (= I178), A199 (≠ C216), T200 (= T217), T201 (≠ A218), A202 (≠ D219), V206 (≠ I225), V221 (≠ I240), G222 (= G241), W223 (≠ G242), S296 (≠ G308), V297 (= V309), G298 (= G310)
- binding proline: M54 (= M74), K67 (= K85), R110 (= R128)
Sites not aligning to the query:
5gziA Cyclodeaminase_pa
31% identity, 79% coverage: 69:350/357 of query aligns to 64:347/354 of 5gziA
- binding nicotinamide-adenine-dinucleotide: Y85 (≠ G89), T97 (= T100), R125 (= R128), T126 (= T129), G151 (= G154), A152 (= A155), Q153 (= Q156), D174 (= D177), T175 (≠ I178), H179 (≠ A182), A212 (≠ C216), T213 (= T217), S214 (≠ A218), V215 (≠ D219), V237 (≠ I240), G238 (= G241), A239 (≠ G242), S305 (≠ G308), T306 (≠ V309), G307 (= G310)
- binding (2S)-piperidine-2-carboxylic acid: K81 (= K85), R125 (= R128), A239 (≠ G242), T306 (≠ V309), G307 (= G310)
Sites not aligning to the query:
5gzlA Cyclodeaminase_pa
31% identity, 79% coverage: 69:350/357 of query aligns to 64:347/357 of 5gzlA
- binding lysine: I65 (≠ V70), E67 (= E72), D240 (= D243), R267 (≠ I270), E268 (= E271)
- binding nicotinamide-adenine-dinucleotide: Y85 (≠ G89), T97 (= T100), I98 (≠ V101), T126 (= T129), G151 (= G154), A152 (= A155), Q153 (= Q156), D174 (= D177), T175 (≠ I178), H179 (≠ A182), A212 (≠ C216), T213 (= T217), S214 (≠ A218), V222 (≠ I225), V237 (≠ I240), G238 (= G241), A239 (≠ G242), D240 (= D243), K244 (= K247), S305 (≠ G308), T306 (≠ V309), G307 (= G310)
Sites not aligning to the query:
5yu4A Structural basis for recognition of l-lysine, l-ornithine, and l-2,4- diamino butyric acid by lysine cyclodeaminase (see paper)
31% identity, 79% coverage: 69:350/357 of query aligns to 60:343/344 of 5yu4A
- binding 2,4-diaminobutyric acid: E63 (= E72), K77 (= K85), R121 (= R128), T302 (≠ V309), G303 (= G310)
- binding nicotinamide-adenine-dinucleotide: Y81 (≠ G89), T93 (= T100), I94 (≠ V101), R121 (= R128), T122 (= T129), G147 (= G154), A148 (= A155), Q149 (= Q156), D170 (= D177), T171 (≠ I178), H175 (≠ A182), A208 (≠ C216), T209 (= T217), S210 (≠ A218), V211 (≠ D219), V218 (≠ I225), V233 (≠ I240), A235 (≠ G242), S301 (≠ G308), T302 (≠ V309), G303 (= G310)
5yu3A Structural basis for recognition of l-lysine, l-ornithine, and l-2,4- diamino butyric acid by lysine cyclodeaminase (see paper)
31% identity, 79% coverage: 69:350/357 of query aligns to 60:343/344 of 5yu3A
- binding nicotinamide-adenine-dinucleotide: Y81 (≠ G89), T93 (= T100), I94 (≠ V101), T122 (= T129), G147 (= G154), A148 (= A155), Q149 (= Q156), D170 (= D177), T171 (≠ I178), A208 (≠ C216), T209 (= T217), S210 (≠ A218), V211 (≠ D219), V233 (≠ I240), A235 (≠ G242), S301 (≠ G308), T302 (≠ V309), G303 (= G310)
- binding proline: M65 (= M74), K77 (= K85), R121 (= R128)
6rqaB Crystal structure of the iminosuccinate reductase of paracoccus denitrificans in complex with NAD+ (see paper)
32% identity, 71% coverage: 83:337/357 of query aligns to 67:322/322 of 6rqaB
- binding Tb-Xo4: N76 (≠ R92)
- binding nicotinamide-adenine-dinucleotide: T113 (= T129), G138 (= G154), Q140 (= Q156), P162 (≠ A181), H163 (≠ A182), I199 (≠ A218), T200 (≠ D219), S201 (≠ K220), S202 (≠ Q221), M221 (≠ I240), G222 (= G241), D224 (= D243), K228 (= K247), G293 (= G308), T294 (≠ V309), G295 (= G310)
Sites not aligning to the query:
6rqaA Crystal structure of the iminosuccinate reductase of paracoccus denitrificans in complex with NAD+ (see paper)
32% identity, 71% coverage: 83:337/357 of query aligns to 67:322/322 of 6rqaA
- binding nicotinamide-adenine-dinucleotide: H85 (≠ V101), T113 (= T129), G138 (= G154), H139 (≠ A155), Q140 (= Q156), N161 (≠ R180), P162 (≠ A181), H163 (≠ A182), M166 (≠ K185), I199 (≠ A218), T200 (≠ D219), S201 (≠ K220), S202 (≠ Q221), M221 (≠ I240), G222 (= G241), D224 (= D243), K228 (= K247), G293 (= G308)
A1B8Z0 Iminosuccinate reductase; EC 1.4.1.- from Paracoccus denitrificans (strain Pd 1222) (see paper)
32% identity, 71% coverage: 83:337/357 of query aligns to 65:320/320 of A1B8Z0
4m54A The structure of the staphyloferrin b precursor biosynthetic enzyme sbnb bound to n-(1-amino-1-carboxyl-2-ethyl)-glutamic acid and nadh (see paper)
25% identity, 82% coverage: 31:322/357 of query aligns to 18:294/310 of 4m54A
- active site: I55 (= I71), M231 (≠ T248)
- binding N-[(2S)-2-amino-2-carboxyethyl]-L-glutamic acid: Y45 (≠ R61), R53 (≠ G69), M57 (= M74), K71 (= K85), I73 (≠ V87), R87 (≠ T100), R115 (= R128)
- binding 1,4-dihydronicotinamide adenine dinucleotide: R87 (≠ T100), T116 (= T129), G141 (= G154), L142 (≠ A155), I143 (≠ Q156), D165 (= D177), Q166 (≠ I178), T207 (= T217), T209 (≠ D219), I228 (= I240)
4mp6A Staphyloferrin b precursor biosynthetic enzyme sbnb bound to citrate and NAD+ (see paper)
26% identity, 70% coverage: 74:322/357 of query aligns to 62:318/334 of 4mp6A
- active site: M236 (≠ T248)
- binding nicotinamide-adenine-dinucleotide: R92 (≠ T100), R120 (= R128), T121 (= T129), G146 (= G154), L147 (≠ A155), I148 (≠ Q156), D170 (= D177), Q171 (≠ I178), C211 (= C216), T212 (= T217), V213 (≠ A218), I233 (= I240), G306 (= G310)
Sites not aligning to the query:
4bv9A Crystal structure of the NADPH form of mouse mu-crystallin. (see paper)
29% identity, 57% coverage: 123:325/357 of query aligns to 105:300/303 of 4bv9A
- active site: S220 (≠ D243)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: T111 (= T129), G134 (= G152), G136 (= G154), V137 (≠ A155), Q138 (= Q156), N159 (≠ D177), R160 (≠ I178), T161 (≠ D179), V195 (≠ C216), T196 (= T217), M197 (≠ A218), A198 (≠ D219), V217 (≠ I240), G218 (= G241), S283 (≠ G308), L284 (≠ V309), G285 (= G310)
- binding pyruvic acid: R110 (= R128)
Sites not aligning to the query:
4bvaA Crystal structure of the NADPH-t3 form of mouse mu-crystallin. (see paper)
30% identity, 57% coverage: 123:324/357 of query aligns to 104:298/303 of 4bvaA
- active site: S219 (≠ D243)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: T106 (= T125), R109 (= R128), T110 (= T129), G135 (= G154), V136 (≠ A155), Q137 (= Q156), N158 (≠ D177), R159 (≠ I178), T160 (≠ D179), N163 (≠ A182), V194 (≠ C216), T195 (= T217), M196 (≠ A218), A197 (≠ D219), V216 (≠ I240), S282 (≠ G308), L283 (≠ V309), G284 (= G310)
- binding 3,5,3'triiodothyronine: S219 (≠ D243), R220 (≠ C244), W223 (≠ K247), E247 (= E271)
Sites not aligning to the query:
4mpdA Staphyloferrin b precursor biosynthetic enzyme sbnb bound a- ketoglutarate and NAD+ (see paper)
26% identity, 67% coverage: 83:322/357 of query aligns to 62:302/318 of 4mpdA
- active site: M224 (≠ T248)
- binding 2-oxoglutaric acid: K64 (= K85), I66 (≠ V87), R80 (≠ T100), M289 (≠ V309)
- binding nicotinamide-adenine-dinucleotide (acidic form): R80 (≠ T100), R108 (= R128), T109 (= T129), G134 (= G154), I136 (≠ Q156), D158 (= D177), Q159 (≠ I178), F160 (≠ D179), T200 (= T217), V201 (≠ A218), I221 (= I240)
Sites not aligning to the query:
2i99A Crystal structure of human mu_crystallin at 2.6 angstrom (see paper)
28% identity, 57% coverage: 123:324/357 of query aligns to 113:307/312 of 2i99A
- active site: S228 (≠ D243)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R118 (= R128), T119 (= T129), G142 (= G152), A143 (≠ N153), G144 (= G154), V145 (≠ A155), Q146 (= Q156), N167 (≠ D177), R168 (≠ I178), T169 (≠ D179), V203 (≠ C216), T204 (= T217), L205 (≠ A218), A206 (≠ D219), V225 (≠ I240), G226 (= G241), S291 (≠ G308), L292 (≠ V309), G293 (= G310)
Sites not aligning to the query:
Q14894 Ketimine reductase mu-crystallin; NADP-regulated thyroid-hormone-binding protein; EC 1.5.1.25 from Homo sapiens (Human) (see paper)
28% identity, 57% coverage: 123:324/357 of query aligns to 114:308/314 of Q14894
Query Sequence
>3608919 FitnessBrowser__Dino:3608919
MSASANDPVPGPSDLAYIRFVSVENMMKLVHSIGIETMLRDLARYIEDDFRRWEKFDKTP
RVASHSPEGVIELMPTSDGEDYGFKYVNGHPRNTKDGLQTVTAFGLLARVDTGYPELLTE
MTVLTALRTAATSAMVASHLAPKGSRVMAMIGNGAQSEFQALAMRAICGIDTLRLYDIDR
AATEKVRRNLTGQGFELIPCATPEEAIEGAQIITTCTADKQFATILTDNMVGAGLHINAI
GGDCPGKTELHKDILIRSDVFVEYPPQTRIEGEIQQMPEDFPVTEMWQVITGAAPGRIND
RQITLFDGVGFAIEDFSALRYLRDKLKDHPFYEDLDIIADPDDPRDLFGMIQRARPR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory