Comparing 3608953 FitnessBrowser__Dino:3608953 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7ug8B Crystal structure of a solute receptor from synechococcus cc9311 in complex with alpha-ketovaleric and calcium
42% identity, 79% coverage: 37:320/361 of query aligns to 9:292/330 of 7ug8B
4petA Crystal structure of a trap periplasmic solute binding protein from colwellia psychrerythraea (cps_0129, target efi-510097) with bound calcium and pyruvate (see paper)
38% identity, 88% coverage: 37:354/361 of query aligns to 8:327/329 of 4petA
5cm6A Crystal structure of a trap periplasmic solute binding protein from pseudoalteromonas atlantica t6c(patl_2292, target efi-510180) with bound sodium and pyruvate
38% identity, 88% coverage: 37:354/361 of query aligns to 7:326/331 of 5cm6A
Q3J1R2 Alpha-keto acid-binding periplasmic protein TakP; Extracytoplasmic solute receptor protein TakP; TRAP transporter alpha-keto acid-binding subunit P; TRAP-T family sorbitol/mannitol transporter, periplasmic binding protein, SmoM from Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) (Rhodobacter sphaeroides) (see paper)
33% identity, 99% coverage: 1:357/361 of query aligns to 1:361/365 of Q3J1R2
4yicA Crystal structure of a trap transporter solute binding protein (ipr025997) from bordetella bronchiseptica rb50 (bb0280, target efi- 500035) with bound picolinic acid
36% identity, 81% coverage: 29:320/361 of query aligns to 1:292/344 of 4yicA
2hzlB Crystal structures of a sodium-alpha-keto acid binding subunit from a trap transporter in its closed forms (see paper)
33% identity, 90% coverage: 34:357/361 of query aligns to 5:333/337 of 2hzlB
Q5SK82 Lactate-binding periplasmic protein TTHA0766; ABC transporter, solute-binding protein; Extracytoplasmic solute receptor protein TTHA0766; TRAP transporter lactate-binding subunit P from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
28% identity, 84% coverage: 1:305/361 of query aligns to 4:311/361 of Q5SK82
Sites not aligning to the query:
2zzwA Crystal structure of a periplasmic substrate binding protein in complex with zinc and lactate (see paper)
28% identity, 70% coverage: 55:305/361 of query aligns to 24:280/330 of 2zzwA
2zzvA Crystal structure of a periplasmic substrate binding protein in complex with calcium and lactate (see paper)
28% identity, 70% coverage: 55:305/361 of query aligns to 24:280/330 of 2zzvA
4pe3A Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_3620, target efi-510199), apo open structure (see paper)
27% identity, 68% coverage: 55:301/361 of query aligns to 22:268/315 of 4pe3A
Sites not aligning to the query:
7e9yA Crystal structure of elacco1 (see paper)
32% identity, 44% coverage: 55:212/361 of query aligns to 24:182/563 of 7e9yA
Sites not aligning to the query:
4uabA Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_0678), target efi-501078, with bound ethanolamine (see paper)
25% identity, 72% coverage: 60:320/361 of query aligns to 27:284/315 of 4uabA
Sites not aligning to the query:
4xf5A Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_0678), target efi-501078, with bound (s)-(+)-2-amino-1-propanol.
25% identity, 72% coverage: 60:320/361 of query aligns to 28:285/317 of 4xf5A
Sites not aligning to the query:
4x8rA Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_2138, target efi-510205) with bound glucuronate
29% identity, 50% coverage: 121:301/361 of query aligns to 79:269/304 of 4x8rA
Sites not aligning to the query:
4xfeA Crystal structure of a trap periplasmic solute binding protein from pseudomonas putida f1 (pput_1203), target efi-500184, with bound d- glucuronate
26% identity, 46% coverage: 133:297/361 of query aligns to 100:263/306 of 4xfeA
Sites not aligning to the query:
4mncA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp. Js666 (bpro_4736), target efi-510156, with bound benzoyl formate, space group p21 (see paper)
23% identity, 79% coverage: 34:317/361 of query aligns to 4:276/305 of 4mncA
4pgpA Crystal structure of a trap periplasmic solute binding protein from desulfovibrio alaskensis g20 (dde_0634, target efi-510120) with bound 3-indole acetic acid (see paper)
25% identity, 54% coverage: 75:270/361 of query aligns to 43:231/308 of 4pgpA
Sites not aligning to the query:
4pgnA Crystal structure of a trap periplasmic solute binding protein from desulfovibrio alaskensis g20 (dde_0634, target efi-510120) with bound indole pyruvate (see paper)
25% identity, 54% coverage: 75:270/361 of query aligns to 43:231/308 of 4pgnA
Sites not aligning to the query:
4napD Crystal structure of a trap periplasmic solute binding protein from desulfovibrio alaskensis g20 (dde_0634), target efi-510102, with bound d-tryptophan (see paper)
25% identity, 54% coverage: 75:270/361 of query aligns to 43:231/310 of 4napD
Sites not aligning to the query:
7a5qB Crystal structure of vcsiap bound to sialic acid (see paper)
24% identity, 78% coverage: 50:330/361 of query aligns to 18:296/299 of 7a5qB
Sites not aligning to the query:
>3608953 FitnessBrowser__Dino:3608953
MDRRSFLRTSALGGTAAAASAGLAAPAIAQSTRTLTMVTSWPRGFAVLDDAATYFNEAVN
AMSGGSLIIEKKAPGELVGAFEVFDAVAAGQADIYHSADYYWIGQHPGYAYFCAVPFGAT
AQELTNWYYHDGGQDLHNELGAIFGMHSMQCGNSGSQSGGWFRNEITSAEDFNGLRFRMP
GLGGQVLGKLGASVQNIPGGELYQALSSGALDGLEWVGPAADEKAGFQEVAKIYYTAGFH
EPGSGLTASVNLDVWNELSPEHQAIMDNAAKATTNYQLSQTLAMNGAALARLQAQGVRTL
QFPDDVWDAFGAASKEVLDENMGDELYAKIRNSFDASLAKSSDWLLKSDAYFVEQRNRVL
G
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory