SitesBLAST
Comparing 3609008 FitnessBrowser__Dino:3609008 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P31120 Phosphoglucosamine mutase; EC 5.4.2.10 from Escherichia coli (strain K12) (see 3 papers)
51% identity, 99% coverage: 3:445/447 of query aligns to 4:444/445 of P31120
- S100 (= S101) mutation to A: 2% of wild-type activity.; mutation to T: 20-fold increase in the non-specific phosphoglucomutase activity towards glucose-phosphate substrates (non aminated).
- S102 (= S103) active site, Phosphoserine intermediate; modified: Phosphoserine; by autocatalysis; mutation to A: Loss of activity in the absence or presence of glucosamine-1,6-diP.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
7omlA Bacillus subtilis phosphoglucomutase glmm (metal bound) (see paper)
46% identity, 99% coverage: 4:445/447 of query aligns to 2:442/445 of 7omlA
7ojrA Bacillus subtilis phosphoglucomutase glmm (phosphate bound) (see paper)
46% identity, 99% coverage: 4:445/447 of query aligns to 2:442/445 of 7ojrA
3i3wA Structure of a phosphoglucosamine mutase from francisella tularensis
39% identity, 99% coverage: 4:444/447 of query aligns to 1:437/441 of 3i3wA
- active site: R9 (= R12), S99 (= S103), H100 (= H104), K109 (= K113), D237 (= D242), D239 (= D244), D241 (= D246), R242 (= R247), H324 (= H331)
- binding zinc ion: S99 (= S103), D237 (= D242), D239 (= D244), D241 (= D246)
1wqaA Crystal structure of pyrococcus horikoshii phosphomannomutase/phosphoglucomutase complexed with mg2+
34% identity, 95% coverage: 4:429/447 of query aligns to 3:436/455 of 1wqaA
- active site: R11 (= R12), S101 (= S103), H102 (= H104), K111 (= K113), D243 (= D242), D245 (= D244), D247 (= D246), R248 (= R247), G330 (≠ H331), R340 (≠ G341)
- binding magnesium ion: S101 (= S103), D243 (= D242), D245 (= D244), D247 (= D246)
6nqhA Xanthomonas citri dephospho-pgm in complex with xylose-1-phosphate
27% identity, 94% coverage: 20:439/447 of query aligns to 19:442/448 of 6nqhA
- active site: S97 (= S103), H98 (= H104), K107 (= K113), D237 (= D242), D239 (= D244), D241 (= D246), R242 (= R247), H324 (= H331)
- binding magnesium ion: D237 (= D242), D239 (= D244), D241 (= D246)
- binding 1-O-phosphono-alpha-D-xylopyranose: S97 (= S103), H98 (= H104), K107 (= K113), D239 (= D244), R242 (= R247), R280 (≠ T281), S301 (≠ V308), G302 (= G309), E320 (= E327), S322 (= S329), H324 (= H331), R414 (= R412), S416 (= S414), N417 (≠ G415), T418 (= T416), R423 (= R421)
Sites not aligning to the query:
6np8A Xanthomonas citri phospho-pgm in complex with mannose-6-phosphate (see paper)
27% identity, 94% coverage: 20:439/447 of query aligns to 19:442/448 of 6np8A
- active site: S97 (= S103), H98 (= H104), K107 (= K113), D237 (= D242), D239 (= D244), D241 (= D246), R242 (= R247), H324 (= H331)
- binding calcium ion: S97 (= S103), D237 (= D242), D239 (= D244), D241 (= D246)
- binding 6-O-phosphono-alpha-D-mannopyranose: R280 (≠ T281), G302 (= G309), H303 (≠ D310), E320 (= E327), S322 (= S329), H324 (= H331), R414 (= R412), S416 (= S414), N417 (≠ G415), T418 (= T416), R423 (= R421)
Sites not aligning to the query:
6nolA Xanthomonas citri dephospho-pgm in complex with mannose-1-phosphate (see paper)
27% identity, 94% coverage: 20:439/447 of query aligns to 19:442/448 of 6nolA
- active site: S97 (= S103), H98 (= H104), K107 (= K113), D237 (= D242), D239 (= D244), D241 (= D246), R242 (= R247), H324 (= H331)
- binding 1-O-phosphono-alpha-D-mannopyranose: G302 (= G309), E320 (= E327), S322 (= S329), H324 (= H331), R414 (= R412), S416 (= S414), N417 (≠ G415), T418 (= T416), R423 (= R421)
- binding magnesium ion: S97 (= S103), D237 (= D242), D239 (= D244), D241 (= D246)
Sites not aligning to the query:
6nnpA Xanthomonas citri dephospho-pgm in complex with glucose-6-phosphate (see paper)
27% identity, 94% coverage: 20:439/447 of query aligns to 19:442/448 of 6nnpA
- active site: S97 (= S103), H98 (= H104), K107 (= K113), D237 (= D242), D239 (= D244), D241 (= D246), R242 (= R247), H324 (= H331)
- binding 6-O-phosphono-alpha-D-glucopyranose: R280 (≠ T281), G302 (= G309), H303 (≠ D310), E320 (= E327), H324 (= H331), R414 (= R412), S416 (= S414), N417 (≠ G415), T418 (= T416), R423 (= R421)
- binding magnesium ion: S97 (= S103), D237 (= D242), D239 (= D244), D241 (= D246)
Sites not aligning to the query:
6nn2A Xanthomonas citri pgm apo-phospho (see paper)
27% identity, 94% coverage: 20:439/447 of query aligns to 19:442/448 of 6nn2A
- active site: S97 (= S103), H98 (= H104), K107 (= K113), D237 (= D242), D239 (= D244), D241 (= D246), R242 (= R247), H324 (= H331)
- binding calcium ion: S97 (= S103), D237 (= D242), D239 (= D244), D241 (= D246)
Sites not aligning to the query:
6n1eA Crystal structure of x. Citri phosphoglucomutase in complex with 1- methyl-glucose 6-phosphate (see paper)
27% identity, 94% coverage: 20:439/447 of query aligns to 19:442/448 of 6n1eA
6mnvA Crystal structure of x. Citri phosphoglucomutase in complex with ch2fg1p (see paper)
27% identity, 94% coverage: 20:439/447 of query aligns to 19:442/448 of 6mnvA
- binding 1-deoxy-1-fluoro-2-O-phosphono-alpha-D-gluco-hept-2-ulopyranose: R280 (≠ T281), G302 (= G309), E320 (= E327), S322 (= S329), H324 (= H331), R414 (= R412), S416 (= S414), N417 (≠ G415), T418 (= T416), R423 (= R421)
- binding magnesium ion: S97 (= S103), D237 (= D242), D239 (= D244), D241 (= D246)
6mlhA Crystal structure of x. Citri phosphoglucomutase in complex with glucopyranosyl-1-methyl-phosphonic acid (see paper)
27% identity, 94% coverage: 20:439/447 of query aligns to 19:442/448 of 6mlhA
- active site: S97 (= S103), H98 (= H104), K107 (= K113), D237 (= D242), D239 (= D244), D241 (= D246), R242 (= R247), H324 (= H331)
- binding (1S)-1,5-anhydro-1-(phosphonomethyl)-D-glucitol: R280 (≠ T281), G302 (= G309), E320 (= E327), H324 (= H331), R414 (= R412), S416 (= S414), N417 (≠ G415), T418 (= T416), R423 (= R421)
- binding magnesium ion: S97 (= S103), D237 (= D242), D239 (= D244), D241 (= D246)
Sites not aligning to the query:
6mlfA Crystal structure of x. Citri phosphoglucomutase in complex with 6- fluoro glucose 1-phosphate (see paper)
27% identity, 94% coverage: 20:439/447 of query aligns to 19:442/448 of 6mlfA
- active site: S97 (= S103), H98 (= H104), K107 (= K113), D237 (= D242), D239 (= D244), D241 (= D246), R242 (= R247), H324 (= H331)
- binding 6-deoxy-6-fluoro-1-O-phosphono-alpha-D-glucopyranose: R280 (≠ T281), G302 (= G309), E320 (= E327), H324 (= H331), R414 (= R412), S416 (= S414), T418 (= T416), R423 (= R421)
- binding magnesium ion: S97 (= S103), D237 (= D242), D239 (= D244), D241 (= D246)
Sites not aligning to the query:
5kl0A Crystal structure of phosphoglucomutase from xanthomonas citri citri complexed with glucose-1,6-biphosphate (see paper)
27% identity, 94% coverage: 20:439/447 of query aligns to 19:442/448 of 5kl0A
- active site: S97 (= S103), H98 (= H104), K107 (= K113), D237 (= D242), D239 (= D244), D241 (= D246), R242 (= R247), H324 (= H331)
- binding 1,6-di-O-phosphono-alpha-D-glucopyranose: S97 (= S103), G302 (= G309), H303 (≠ D310), E320 (= E327), H324 (= H331), R414 (= R412), S416 (= S414), N417 (≠ G415), R423 (= R421)
- binding magnesium ion: S97 (= S103), D237 (= D242), D239 (= D244), D241 (= D246)
Sites not aligning to the query:
6mlwA Crystal structure of x. Citri phosphoglucomutase in complex with 2- fluoro mannosyl-1-methyl-phosphonic acid (see paper)
27% identity, 94% coverage: 20:439/447 of query aligns to 20:443/449 of 6mlwA
- active site: S98 (= S103), H99 (= H104), K108 (= K113), D238 (= D242), D240 (= D244), D242 (= D246), R243 (= R247), H325 (= H331)
- binding 2,6-anhydro-5,7-dideoxy-5-fluoro-7-phosphono-D-glycero-D-manno-heptitol: G303 (= G309), H304 (≠ D310), E321 (= E327), S323 (= S329), H325 (= H331), R415 (= R412), S417 (= S414), N418 (≠ G415), T419 (= T416), R424 (= R421)
- binding magnesium ion: S98 (= S103), D238 (= D242), D240 (= D244), D242 (= D246)
Sites not aligning to the query:
5bmpA Crystal structure of phosphoglucomutase from xanthomonas citri complexed with glucose-1-phosphate (see paper)
27% identity, 94% coverage: 20:439/447 of query aligns to 20:443/449 of 5bmpA
- active site: S98 (= S103), H99 (= H104), K108 (= K113), D238 (= D242), D240 (= D244), D242 (= D246), R243 (= R247), H325 (= H331)
- binding 1-O-phosphono-alpha-D-glucopyranose: R281 (≠ T281), G303 (= G309), E321 (= E327), S323 (= S329), H325 (= H331), R415 (= R412), S417 (= S414), N418 (≠ G415), T419 (= T416), R424 (= R421)
- binding magnesium ion: S98 (= S103), D238 (= D242), D240 (= D244), D242 (= D246)
Sites not aligning to the query:
1pcjX Enzyme-ligand complex of p. Aeruginosa pmm/pgm (see paper)
27% identity, 96% coverage: 5:435/447 of query aligns to 8:439/458 of 1pcjX
- active site: R15 (= R12), S103 (= S103), H104 (= H104), K113 (= K113), D237 (= D242), D239 (= D244), D241 (= D246), R242 (= R247), H324 (= H331), D335 (= D342)
- binding 1-O-phosphono-alpha-D-mannopyranose: Y12 (≠ D9), S103 (= S103), T301 (≠ V308), G302 (= G309), E320 (= E327), S322 (= S329), H324 (= H331), R416 (= R412), S418 (= S414), N419 (≠ G415), T420 (= T416)
- binding zinc ion: S103 (= S103), D237 (= D242), D239 (= D244), D241 (= D246)
2h5aX Complex of the enzyme pmm/pgm with xylose 1-phosphate (see paper)
26% identity, 96% coverage: 5:435/447 of query aligns to 5:436/455 of 2h5aX
- active site: H101 (= H104), D234 (= D242), D236 (= D244), D238 (= D246), R239 (= R247), D332 (= D342)
- binding 1-O-phosphono-alpha-D-xylopyranose: Y9 (≠ D9), T298 (≠ V308), G299 (= G309), H300 (≠ D310), E317 (= E327), S319 (= S329), H321 (= H331), R413 (= R412), S415 (= S414), N416 (≠ G415), T417 (= T416)
- binding zinc ion: S100 (= S103), D234 (= D242), D236 (= D244), D238 (= D246)
2h4lX Complex of pmm/pgm with ribose 1-phosphate (see paper)
26% identity, 96% coverage: 5:435/447 of query aligns to 5:436/455 of 2h4lX
- active site: H101 (= H104), D234 (= D242), D236 (= D244), D238 (= D246), R239 (= R247), D332 (= D342)
- binding 1-O-phosphono-alpha-D-ribofuranose: Y9 (≠ D9), R12 (= R12), S100 (= S103), T298 (≠ V308), E317 (= E327), R413 (= R412), S415 (= S414), N416 (≠ G415), T417 (= T416)
- binding zinc ion: S100 (= S103), D234 (= D242), D236 (= D244), D238 (= D246)
Query Sequence
>3609008 FitnessBrowser__Dino:3609008
MARKLFGTDGVRGTANTAPMTAEMALRLGAAAGRYFRRDQSAAHRVVIGKDTRLSGYMFE
TALTAGFTSTGMNVLLLGPIPTPAVALLTQSMRADVGVMISASHNPADDNGIKFFGPDGY
KLSDAAEEEIEEILAGDIRPAQAPNIGRAKRIDDGLGRYIERAKRTFPAHLRLDGLKVVV
DCANGAAYKVAPAVLWELGADVIPVGVSPNGRNINRDCGSTAPQTAAEAVVSHGADVGIC
LDGDADRVMILDENGELADGDQLMALFATRWAAQGLLRDNTLVATVMSNLGLEYYLNDLG
LKLVRTAVGDRYVVEAMRKGGWNLGGEQSGHIVMLDHGTTGDGLMAGLQFLAEMVQQGRS
ASELKHSFTTVPQRLENVRFGAGQDPLAAASVKSAIAAAEAQLSGKGRLLIRKSGTEPLV
RVMAECEDEAMLTSVVGEVVAAVEAAC
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory