Comparing 3609041 FitnessBrowser__Dino:3609041 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
2qlxA Crystal structure of rhamnose mutarotase rhau of rhizobium leguminosarum in complex with l-rhamnose (see paper)
69% identity, 93% coverage: 9:112/112 of query aligns to 5:108/108 of 2qlxA
2qlwB Crystal structure of rhamnose mutarotase rhau of rhizobium leguminosarum (see paper)
69% identity, 93% coverage: 9:112/112 of query aligns to 5:108/108 of 2qlwB
1x8dA Crystal structure of e. Coli yiil protein containing l-rhamnose (see paper)
40% identity, 93% coverage: 9:112/112 of query aligns to 1:104/104 of 1x8dA
P32156 L-rhamnose mutarotase; Rhamnose 1-epimerase; Type-3 mutarotase; EC 5.1.3.32 from Escherichia coli (strain K12) (see paper)
40% identity, 93% coverage: 9:112/112 of query aligns to 1:104/104 of P32156
>3609041 FitnessBrowser__Dino:3609041
MVHVAGALMEKIAFKMMLNPGCREEYIKRHDAIWPELVDLLRKAGVSDYSIHLDPETDTL
FAVLWRKEGHGMDDLPSHPVMQKWWAHMADIMQTQPDNAPVVTPLDTVFHMP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory