Comparing 3609045 FitnessBrowser__Dino:3609045 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1tjyA Crystal structure of salmonella typhimurium ai-2 receptor lsrb in complex with r-thmf (see paper)
34% identity, 90% coverage: 31:329/333 of query aligns to 5:314/316 of 1tjyA
4wzzA Crystal structure of an abc transporter solute binding protein (ipr025997) from clostridium phytofermentas (cphy_0583, target efi- 511148) with bound l-rhamnose
36% identity, 90% coverage: 33:333/333 of query aligns to 8:321/321 of 4wzzA
3t95A Crystal structure of lsrb from yersinia pestis complexed with autoinducer-2 (see paper)
35% identity, 84% coverage: 31:310/333 of query aligns to 3:281/314 of 3t95A
4pz0A The crystal structure of a solute binding protein from bacillus anthracis str. Ames in complex with quorum-sensing signal autoinducer-2 (ai-2)
28% identity, 91% coverage: 28:329/333 of query aligns to 6:319/321 of 4pz0A
3ejwA Crystal structure of the sinorhizobium meliloti ai-2 receptor, smlsrb (see paper)
34% identity, 85% coverage: 29:310/333 of query aligns to 1:282/315 of 3ejwA
6dspA Lsrb from clostridium saccharobutylicum in complex with ai-2 (see paper)
28% identity, 86% coverage: 32:318/333 of query aligns to 3:296/326 of 6dspA
5hqjA Crystal structure of abc transporter solute binding protein b1g1h7 from burkholderia graminis c4d1m, target efi-511179, in complex with d-arabinose
28% identity, 72% coverage: 35:274/333 of query aligns to 11:251/289 of 5hqjA
2h3hA Crystal structure of the liganded form of thermotoga maritima glucose binding protein (see paper)
24% identity, 73% coverage: 43:284/333 of query aligns to 14:252/313 of 2h3hA
Sites not aligning to the query:
3c6qC Apo and ligand-bound form of a thermophilic glucose/xylose binding protein
24% identity, 73% coverage: 43:284/333 of query aligns to 14:252/305 of 3c6qC
Sites not aligning to the query:
5dkvA Crystal structure of an abc transporter solute binding protein from agrobacterium vitis(avis_5339, target efi-511225) bound with alpha-d- tagatopyranose
29% identity, 79% coverage: 24:287/333 of query aligns to 1:272/303 of 5dkvA
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
28% identity, 67% coverage: 28:250/333 of query aligns to 1:229/287 of 5dteB
Sites not aligning to the query:
2fn8A Thermotoga maritima ribose binding protein ribose bound form (see paper)
25% identity, 69% coverage: 31:260/333 of query aligns to 3:235/292 of 2fn8A
Sites not aligning to the query:
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
27% identity, 69% coverage: 32:260/333 of query aligns to 3:227/274 of 2ioyA
Sites not aligning to the query:
6gt9A Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with galactose
20% identity, 84% coverage: 27:307/333 of query aligns to 4:283/283 of 6gt9A
6guqA Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with glucose
20% identity, 82% coverage: 34:307/333 of query aligns to 6:278/278 of 6guqA
4ry8B Crystal structure of 5-methylthioribose transporter solute binding protein tlet_1677 from thermotoga lettingae tmo target efi-511109 in complex with 5-methylthioribose
30% identity, 67% coverage: 30:252/333 of query aligns to 10:229/321 of 4ry8B
7x0hA Crystal structure of sugar binding protein cbpa complexed wtih glucose from clostridium thermocellum (see paper)
38% identity, 28% coverage: 40:131/333 of query aligns to 18:108/287 of 7x0hA
Sites not aligning to the query:
5ibqA Crystal structure of an abc solute binding protein from rhizobium etli cfn 42 (rhe_pf00037,target efi-511357) in complex with alpha-d-apiose
29% identity, 70% coverage: 32:264/333 of query aligns to 5:234/287 of 5ibqA
4ry0A Crystal structure of ribose transporter solute binding protein rhe_pf00037 from rhizobium etli cfn 42, target efi-511357, in complex with d-ribose
29% identity, 70% coverage: 32:264/333 of query aligns to 5:234/287 of 4ry0A
Sites not aligning to the query:
A0QYB5 D-threitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
25% identity, 75% coverage: 12:260/333 of query aligns to 17:261/349 of A0QYB5
Sites not aligning to the query:
>3609045 FitnessBrowser__Dino:3609045
MKRRTFTKLTAGLSLAASLFGTTAMAQDEMRIALVVKALGIGFFEAAAQGAEEAAAELGG
VEIIYTGPTDTTAEGQIEVINSLIAQGVDAIAVSANDTDALVPTLKKAMQRGITVISWDS
GVAPEGRQMHLNPSSNALIGNMIIKLAADHLPDGGDVAVLSATTTSTNQNIWIEEMTKVL
GDYPGINVVSTVYGDDLADKSYREAQGLMQSFPDLDAIIAPTSVGIVAAAQAVADAGKIG
QVNVTGLGLPSEMAGAIESGASKSFAIWNPIDLGYSAAMIAHALASGAATAEPGTEISIG
RVGTITLDENNEAAMADPFIYDASNIDQFKSIF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory