Comparing 3609052 FitnessBrowser__Dino:3609052 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
2f5xB Structure of periplasmic binding protein bugd (see paper)
29% identity, 82% coverage: 26:287/320 of query aligns to 1:264/300 of 2f5xB
8hkbA Tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d (see paper)
31% identity, 81% coverage: 32:290/320 of query aligns to 5:265/302 of 8hkbA
5okuA R. Palustris rpa4515 with adipate (see paper)
30% identity, 74% coverage: 26:262/320 of query aligns to 1:240/299 of 5okuA
5oeiA R. Palustris rpa4515 with oxoadipate (see paper)
30% identity, 74% coverage: 26:262/320 of query aligns to 1:240/299 of 5oeiA
7ndsA Crystal structure of tphc in a closed conformation (see paper)
26% identity, 82% coverage: 29:290/320 of query aligns to 2:265/294 of 7ndsA
7ndrD Crystal structure of tphc in an open conformation (see paper)
26% identity, 82% coverage: 29:290/320 of query aligns to 2:265/293 of 7ndrD
6hkeB Matc (rpa3494) from rhodopseudomonas palustris with bound malate (see paper)
29% identity, 77% coverage: 41:287/320 of query aligns to 15:264/296 of 6hkeB
Sites not aligning to the query:
2dvzA Structure of a periplasmic transporter (see paper)
29% identity, 86% coverage: 27:300/320 of query aligns to 2:279/300 of 2dvzA
>3609052 FitnessBrowser__Dino:3609052
MTSFKTQIAAVMAGVLALGTSPALADYPERPVTIIVPWGAGGGTDTIIRLFSIGFEEAMG
QPINVVNRTGGSGVVGHSAIANATPDGYTLGACTSEITYFETIGLAPITPASFDLISRLA
VIPAGVTVAADSPYNSLEELIAAAKKGGLSSSGSGLGGPWHMAIAGMMKQVGGDVNTVQF
IPSQGGAPALQDLVAGGISMFTGSPIEARALADAGEVKILGIMSDERSPAFPDVPTLKES
GVDWSLTNWFSLCAPAGLPEDVKARIEAAAEQAHGSAEVQEALAQRGITPLFDGSEAFSS
YAAAFANDAAGLLTDLGLAQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory