SitesBLAST
Comparing 3609054 FitnessBrowser__Dino:3609054 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3w6zA Crystal structure of NADP bound l-serine 3-dehydrogenase (k170m) from hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
35% identity, 83% coverage: 6:244/289 of query aligns to 16:255/296 of 3w6zA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G10), L21 (≠ V11), G22 (= G12), I23 (≠ M13), M24 (= M14), N43 (≠ H34), R44 (= R35), T45 (≠ N36), K48 (≠ P39), V77 (≠ L68), S78 (vs. gap), D82 (= D70), Q85 (≠ A73), V133 (= V121), F244 (= F233), K245 (≠ S234), H248 (≠ N237), K251 (= K240)
2i9pB Crystal structure of human hydroxyisobutyrate dehydrogenase complexed with NAD+
34% identity, 83% coverage: 6:246/289 of query aligns to 3:251/296 of 2i9pB
- binding nicotinamide-adenine-dinucleotide: G9 (= G12), N10 (≠ M13), M11 (= M14), Y29 (≠ L32), D30 (≠ A33), V31 (≠ H34), M63 (≠ C67), L64 (= L68), P65 (= P69), T95 (= T96), V120 (= V121), G122 (= G123), F238 (= F233), K245 (= K240)
P31937 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Homo sapiens (Human) (see paper)
34% identity, 83% coverage: 6:246/289 of query aligns to 42:290/336 of P31937
- LP 103:104 (= LP 68:69) binding
- N108 (vs. gap) binding
- T134 (= T96) binding
- K284 (= K240) binding
Sites not aligning to the query:
- 1:36 modified: transit peptide, Mitochondrion
- 40:68 binding
3ws7A The 1.18 a resolution structure of l-serine 3-dehydrogenase complexed with NADP+ and sulfate ion from the hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
34% identity, 83% coverage: 6:244/289 of query aligns to 16:252/293 of 3ws7A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G10), L21 (≠ V11), G22 (= G12), I23 (≠ M13), M24 (= M14), N43 (≠ H34), R44 (= R35), T45 (≠ N36), K48 (≠ P39), M76 (≠ C67), V77 (≠ L68), S78 (vs. gap), D82 (= D70), Q85 (≠ A73), V133 (= V121), F241 (= F233), K242 (≠ S234), H245 (≠ N237), K248 (= K240)
- binding sulfate ion: T134 (= T122), G135 (= G123), K183 (= K171)
P29266 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Rattus norvegicus (Rat) (see paper)
32% identity, 83% coverage: 6:246/289 of query aligns to 41:289/335 of P29266
- D68 (≠ P39) mutation to R: Decrease of activity with NAD, increase of activity with NADP.
- K208 (= K171) mutation K->A,H,N,R: Complete loss of activity.
- N212 (= N175) mutation to Q: Decrease in activity.
2cvzC Structure of hydroxyisobutyrate dehydrogenase from thermus thermophilus hb8 (see paper)
31% identity, 85% coverage: 3:249/289 of query aligns to 1:243/289 of 2cvzC
- active site: S117 (≠ T122), K165 (= K171), N168 (= N174), N169 (= N175)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G10), L9 (≠ V11), G10 (= G12), A11 (≠ M13), M12 (= M14), N30 (≠ H34), R31 (= R35), T32 (≠ N36), C62 (= C67), L63 (= L68), P64 (= P69), E68 (≠ A73), E71 (≠ G76), S91 (≠ T96), V116 (= V121), F227 (= F233), K234 (= K240)
1wp4A Structure of tt368 protein from thermus thermophilus hb8 (see paper)
31% identity, 84% coverage: 6:249/289 of query aligns to 3:242/288 of 1wp4A
- active site: S116 (≠ T122), K164 (= K171), N167 (= N174), N168 (= N175)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G10), L8 (≠ V11), G9 (= G12), A10 (≠ M13), M11 (= M14), N29 (≠ H34), R30 (= R35), T31 (≠ N36), K34 (≠ P42), C61 (= C67), L62 (= L68), P63 (= P69), E67 (≠ A73), S90 (≠ T96), V115 (= V121), T225 (≠ R232), F226 (= F233), K233 (= K240)
- binding sulfate ion: S116 (≠ T122), G117 (= G123), G118 (= G124), K164 (= K171)
2uyyA Structure of the cytokine-like nuclear factor n-pac
26% identity, 84% coverage: 6:248/289 of query aligns to 9:252/292 of 2uyyA
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4s)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: G15 (= G12), L16 (≠ M13), M17 (= M14), N36 (≠ H34), R37 (= R35), T38 (≠ N36), V70 (≠ L68), S71 (≠ P69), A75 (= A73), T101 (= T96), F237 (= F233), Y238 (≠ S234), Y241 (≠ N237), K244 (= K240)
Q49A26 Cytokine-like nuclear factor N-PAC; NPAC; 3-hydroxyisobutyrate dehydrogenase-like protein; Glyoxylate reductase 1 homolog; Nuclear protein NP60; Nuclear protein of 60 kDa; Nucleosome-destabilizing factor; hNDF; Putative oxidoreductase GLYR1 from Homo sapiens (Human) (see 3 papers)
26% identity, 84% coverage: 6:248/289 of query aligns to 270:513/553 of Q49A26
- 271:285 (vs. 7:21, 47% identical) binding
- T362 (= T96) binding
- M437 (≠ K171) mutation to K: Loss of tetramerization and protein stability.; mutation to N: No effect on tetramerization or protein stability.
- P496 (≠ A231) to L: decreased interaction with GATA4; decreased synergistic activation of GATA4 target genes transcription; detrimental effect on cardiomyocyte differentiation
- K505 (= K240) binding
Sites not aligning to the query:
- 214 D→A: Slightly reduced stimulation of KDM1B demethylase activity, but normal KDM1B-binding.
- 214:217 Interaction with histone H3
- 216 H→A: Slightly reduced stimulation of KDM1B demethylase activity, but normal KDM1B-binding.
- 216:225 Interaction with KDM1B
- 217 Required to promote KDM1B demethylase activity toward histone H3K4me1 and H3K4me2; F→A: Abolished stimulation of KDM1B demethylase activity, reduced affinity for histone H3 of the dimer with KDM1B, but normal KDM1B-binding.
- 219 H→A: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity; when associated with A-223.
- 220:222 FLL→AAA: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity.
- 223 S→A: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity; when associated with A-219.
3pduA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with NADP+ (see paper)
30% identity, 84% coverage: 7:248/289 of query aligns to 5:247/287 of 3pduA
- binding glycerol: R242 (≠ G243), E246 (≠ A247), E246 (≠ A247)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G10), G10 (= G12), I11 (≠ M13), M12 (= M14), N31 (≠ H34), R32 (= R35), N33 (= N36), M64 (≠ C67), L65 (= L68), A66 (≠ P69), A70 (vs. gap), T96 (= T96), V121 (= V121), G123 (= G123), T124 (≠ G124), K171 (= K171), S231 (≠ R232), F232 (= F233), P233 (≠ S234), H236 (≠ N237), K239 (= K240)
Sites not aligning to the query:
Q922P9 Cytokine-like nuclear factor N-PAC; NPAC; Glyoxylate reductase 1 homolog; Nuclear protein NP60; Putative oxidoreductase GLYR1 from Mus musculus (Mouse) (see paper)
27% identity, 84% coverage: 6:248/289 of query aligns to 269:506/546 of Q922P9
- P489 (≠ A231) mutation to L: Mutant animals are born at expected Mendelian ratios. 54% mutants display postnatal lethality between days 0 and 1. They show centricular septal defects.
5u5gA Psf3 in complex with NADP+ and 2-opp (see paper)
29% identity, 84% coverage: 6:249/289 of query aligns to 3:248/286 of 5u5gA
- binding (2-oxopropyl)phosphonic acid: S122 (≠ T122), G123 (= G123), G124 (= G124), K171 (= K171), N175 (= N175), E178 (≠ T178), Y215 (≠ T215)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G7 (= G10), G9 (= G12), R10 (≠ M13), M11 (= M14), N30 (≠ H34), R31 (= R35), S32 (≠ N36), K35 (≠ P39), C63 (= C67), T64 (≠ L68), A65 (≠ P69), A69 (= A73), F73 (≠ L77), S95 (≠ T95), T96 (= T96), V232 (≠ F233), V236 (≠ N237), K239 (= K240)
5je8B The crystal structure of bacillus cereus 3-hydroxyisobutyrate dehydrogenase in complex with NAD (see paper)
25% identity, 84% coverage: 3:245/289 of query aligns to 3:248/294 of 5je8B
3pefA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with NADP+ (see paper)
32% identity, 71% coverage: 7:210/289 of query aligns to 5:210/287 of 3pefA
- binding glycerol: D67 (= D70), G123 (= G123), K171 (= K171), N175 (= N175), M178 (≠ T178), L203 (≠ Y203), G207 (≠ M207)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G12), I11 (≠ M13), M12 (= M14), N31 (= N36), R32 (= R37), S33 (≠ A38), K36 (≠ T41), M64 (≠ C67), L65 (= L68), A66 (≠ P69), A70 (vs. gap), E73 (≠ A73), T96 (= T96), V121 (= V121), G123 (= G123), S124 (≠ G124)
Sites not aligning to the query:
7puaFM uS11m (see paper)
29% identity, 75% coverage: 6:221/289 of query aligns to 8:238/327 of 7puaFM
Sites not aligning to the query:
Q9I5I6 NAD-dependent L-serine dehydrogenase; L-serine 3-dehydrogenase (NAD(+)); EC 1.1.1.387 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
31% identity, 83% coverage: 3:243/289 of query aligns to 1:249/298 of Q9I5I6
- 2:31 (vs. 4:33, 43% identical) binding
- P66 (= P69) binding
- T96 (= T96) binding ; mutation to A: Almost abolished activity.
- S122 (≠ T122) mutation to A: Strongly reduced activity.
- K171 (= K171) active site
- N175 (= N175) mutation to A: Strongly reduced activity.
- W214 (≠ G214) mutation to A: Almost abolished activity.
- Y219 (≠ A219) mutation to A: Strongly reduced activity.
- K246 (= K240) binding ; mutation to A: Almost abolished activity.
- D247 (= D241) mutation to A: Almost abolished activity.
3q3cA Crystal structure of a serine dehydrogenase from pseudomonas aeruginosa pao1 in complex with NAD (see paper)
31% identity, 82% coverage: 6:243/289 of query aligns to 3:247/294 of 3q3cA
- binding nicotinamide-adenine-dinucleotide: G9 (= G12), H10 (≠ M13), M11 (= M14), F29 (≠ L32), D30 (≠ A33), L31 (≠ H34), M63 (≠ C67), L64 (= L68), P65 (= P69), T94 (= T96), V119 (= V121), G121 (= G123), F237 (= F233), K244 (= K240)
5y8lB Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + NAD +(s)-3-hydroxyisobutyrate (s-hiba) (see paper)
30% identity, 83% coverage: 6:245/289 of query aligns to 4:248/290 of 5y8lB
- binding (2~{S})-2-methylpentanedioic acid: T129 (≠ A132), E149 (≠ G152), A152 (≠ S155), G153 (≠ T156), G153 (≠ T156), K154 (≠ A157)
- binding (2S)-2-methyl-3-oxidanyl-propanoic acid: S119 (≠ T122), G120 (= G123), W211 (≠ G214), F236 (= F233)
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G10 (= G12), N11 (≠ M13), M12 (= M14), F30 (≠ R37), D31 (≠ A38), P32 (= P39), M64 (≠ C67), L65 (= L68), T93 (= T96), G121 (= G124), K168 (= K171), L240 (≠ N237), K243 (= K240)
5y8kA Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + l-serine (see paper)
30% identity, 83% coverage: 6:245/289 of query aligns to 4:248/290 of 5y8kA
5y8iA Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + (s)-3-hydroxyisobutyrate (s-hiba) (see paper)
30% identity, 83% coverage: 6:245/289 of query aligns to 3:247/292 of 5y8iA
Query Sequence
>3609054 FitnessBrowser__Dino:3609054
MSLPAVGFIGVGMMGAGMAGCLLSAGHPVTLLAHRNRAPLTPLLDRGAREAPDAVTLLDG
CDVLFTCLPDAEAVAGLADTLLPHTRPGQIWIDTTTSRPETSATLAHRLDAAGAVFSDAP
VTGGPKQAQDGALTSLVGCAAAQFDTIASLVGTYSTAIRRFGDAGTGHAAKLLNNLVTQG
TMVLLSDAFQAAGRLGVDPRALYEVMMTGAARSGTLQKAVPPALDGDYTGARFSISNAAK
DLGYAEALLADALPGRADVAGALAARLGALAAQGRGAEFVTTLFDPNRP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory