Comparing 3609200 Dshi_2586 HpcH/HpaI aldolase (RefSeq) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1dxfA 2-dehydro-3-deoxy-galactarate aldolase from escherichia coli in complex with pyruvate (see paper)
32% identity, 87% coverage: 2:219/251 of query aligns to 5:226/253 of 1dxfA
1dxeA 2-dehydro-3-deoxy-galactarate aldolase from escherichia coli (see paper)
32% identity, 87% coverage: 2:219/251 of query aligns to 5:226/253 of 1dxeA
P23522 5-keto-4-deoxy-D-glucarate aldolase; KDGluc aldolase; KDGlucA; 2-dehydro-3-deoxy-D-glucarate aldolase; 2-keto-3-deoxy-D-glucarate aldolase; 5-dehydro-4-deoxy-D-glucarate aldolase; Alpha-keto-beta-deoxy-D-glucarate aldolase; EC 4.1.2.20 from Escherichia coli (strain K12) (see paper)
32% identity, 87% coverage: 2:219/251 of query aligns to 8:229/256 of P23522
2vwtA Crystal structure of yfau, a metal ion dependent class ii aldolase from escherichia coli k12 - mg-pyruvate product complex (see paper)
30% identity, 89% coverage: 4:226/251 of query aligns to 9:236/256 of 2vwtA
P76469 2-keto-3-deoxy-L-rhamnonate aldolase; KDR aldolase; 2-dehydro-3-deoxyrhamnonate aldolase; 2-keto-3-deoxy acid sugar aldolase; EC 4.1.2.53 from Escherichia coli (strain K12) (see paper)
30% identity, 89% coverage: 4:226/251 of query aligns to 9:236/267 of P76469
4tv5A Crystal structure of citrate synthase sbng (see paper)
29% identity, 91% coverage: 4:232/251 of query aligns to 4:224/245 of 4tv5A
Sites not aligning to the query:
4tv6A Crystal structure of citrate synthase variant sbng e151q (see paper)
29% identity, 91% coverage: 4:232/251 of query aligns to 2:205/225 of 4tv6A
7o5rA Crystal structure of holo-swhpa-mn (hydroxyketoacid aldolase) from sphingomonas wittichii rw1 (see paper)
31% identity, 94% coverage: 14:250/251 of query aligns to 15:251/251 of 7o5rA
8adqA Crystal structure of holo-swhpa-mg (hydroxy ketone aldolase) from sphingomonas wittichii rw1 in complex with hydroxypyruvate and d- glyceraldehyde (see paper)
31% identity, 94% coverage: 14:250/251 of query aligns to 16:252/252 of 8adqA
7ethA Crystal structure of abhpai-zn-pyruvate-propionaldehyde complex, class ii aldolase, hpai from acinetobacter baumannii (see paper)
30% identity, 80% coverage: 3:203/251 of query aligns to 4:210/251 of 7ethA
7et9A Crystal structure of abhpai-zn-pyruvate complex, class ii aldolase, hpai from acinetobacter baumannii (see paper)
30% identity, 80% coverage: 3:203/251 of query aligns to 6:212/254 of 7et9A
7etiA Crystal structure of abhpai-zn-pyruvate-4-hydroxybenzaldehyde complex, class ii aldolase, hpai from acinetobacter baumannii (see paper)
30% identity, 80% coverage: 3:203/251 of query aligns to 6:212/253 of 7etiA
Sites not aligning to the query:
7etfA Crystal structure of abhpai-mn-pyruvate-succinic semialdehyde complex, class ii aldolase, hpai from acinetobacter baumannii (see paper)
30% identity, 80% coverage: 3:203/251 of query aligns to 6:212/253 of 7etfA
7eteA Crystal structure of abhpai-mg-(4r)-kdgal complex, class ii aldolase, hpai from acinetobacter baumannii (see paper)
30% identity, 80% coverage: 3:203/251 of query aligns to 6:212/253 of 7eteA
Sites not aligning to the query:
7etdA Crystal structure of abhpai-zn-(4s)-kdglu complex, class ii aldolase, hpai from acinetobacter baumannii (see paper)
30% identity, 80% coverage: 3:203/251 of query aligns to 6:212/253 of 7etdA
Sites not aligning to the query:
7etcA Crystal structure of abhpai-zn-(4r)-kdgal complex, class ii aldolase, hpai from acinetobacter baumannii (see paper)
30% identity, 80% coverage: 3:203/251 of query aligns to 6:212/253 of 7etcA
7etbA Crystal structure of abhpai-mn-pyruvate complex, class ii aldolase, hpai from acinetobacter baumannii (see paper)
30% identity, 80% coverage: 3:203/251 of query aligns to 6:212/253 of 7etbA
7etaA Crystal structure of abhpai-co-pyruvate complex, class ii aldolase, hpai from acinetobacter baumannii (see paper)
30% identity, 80% coverage: 3:203/251 of query aligns to 6:212/253 of 7etaA
1izcA Crystal structure analysis of macrophomate synthase (see paper)
29% identity, 96% coverage: 12:251/251 of query aligns to 40:278/299 of 1izcA
4b5vA Crystal structures of divalent metal dependent pyruvate aldolase, hpai, in complex with 4-hydroxyl-2-ketoheptane-1,7-dioate (see paper)
31% identity, 81% coverage: 2:204/251 of query aligns to 3:207/251 of 4b5vA
Sites not aligning to the query:
>3609200 Dshi_2586 HpcH/HpaI aldolase (RefSeq)
MDDFRTRMLAGEMLAGTFVKTPAIEMVEVLALSGLDFACLDAEHAPFDRGRIDACLALGL
ALGFPLLVRVAEATPPALMQALDAGAAGVVVPHVDSAAAAARIAKACRYGHGGRGFAGST
RSAGYGTRGMGDVLSDGPKPLVIAQIEDPEGVDACEGIAATPGVDGIFLGPADLSVSHGK
MDQTSPELMAAIDRVGAACAASGKPYMTFTPDVEKAAAWRAHGFSVFFVASEHAWMLQGA
RAVAKGIKALG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory