SitesBLAST
Comparing 3609222 FitnessBrowser__Dino:3609222 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3rc1A Crystal structure of kijd10, a 3-ketoreductase from actinomadura kijaniata incomplex with NADP and tdp-benzene (see paper)
34% identity, 99% coverage: 3:327/328 of query aligns to 1:320/325 of 3rc1A
- active site: K95 (= K98), Y179 (= Y183)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: C10 (≠ A12), A11 (= A13), D12 (≠ K14), I13 (≠ F15), S35 (= S37), R36 (= R38), Y56 (= Y59), P71 (= P74), L72 (= L75), P73 (= P76), H77 (= H80), E94 (= E97), K95 (= K98), I162 (= I166), R163 (= R167), V168 (≠ Q172), D175 (= D179), Y179 (= Y183)
- binding phosphate ion: H278 (≠ A285), K283 (≠ A290)
- binding 5'-O-[(S)-hydroxy{[(S)-hydroxy(phenoxy)phosphoryl]oxy}phosphoryl]thymidine: R16 (≠ E18), R17 (≠ Q19), F152 (= F155), I154 (≠ Y157), P155 (≠ D158), Y233 (≠ P235), T253 (≠ N255)
B3TMR8 dTDP-3,4-didehydro-2,6-dideoxy-alpha-D-glucose 3-reductase; 3-ketoreductase; NADPH-dependent C3-ketoreductase; EC 1.1.1.384 from Actinomadura kijaniata (see paper)
34% identity, 99% coverage: 3:327/328 of query aligns to 8:327/332 of B3TMR8
- 17:23 (vs. 12:18, 29% identical) binding
- SR 42:43 (= SR 37:38) binding
- Y63 (= Y59) binding
- L79 (= L75) binding
- H84 (= H80) binding
- K102 (= K98) active site, Proton donor; mutation K->A,M,Q: Loss of reductase activity.; mutation to E: Retains some activity, but the catalytic efficiency is strongly reduced.
- R170 (= R167) binding
- D182 (= D179) binding
- Y186 (= Y183) mutation to F: Same affinity for dTDP-glucose and NADPH compared to the wild-type. Small reduction of the catalytic efficiency resulting from the conformational flexibility of the nicotinamide ring.
1h6dA Oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol (see paper)
28% identity, 98% coverage: 7:327/328 of query aligns to 36:366/383 of 1h6dA
- active site: K131 (= K98), Y219 (= Y183)
- binding glycerol: K131 (= K98), R202 (vs. gap), D215 (= D179), Y219 (= Y183)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G40 (= G11), L41 (≠ A12), G42 (≠ A13), K43 (= K14), Y44 (≠ F15), S66 (= S37), G67 (≠ R38), K71 (= K42), Y89 (≠ H56), I107 (≠ P74), L108 (= L75), P109 (= P76), N110 (≠ H77), H113 (= H80), E130 (= E97), K131 (= K98), R159 (≠ M126), A198 (= A170), W201 (vs. gap), R202 (vs. gap), Y219 (= Y183), Y298 (≠ F259)
Sites not aligning to the query:
1rydA Crystal structure of glucose-fructose oxidoreductase from zymomonas mobilis
28% identity, 98% coverage: 7:327/328 of query aligns to 34:364/381 of 1rydA
- active site: K129 (= K98), Y217 (= Y183)
- binding alpha-D-glucopyranose: Y236 (≠ I199), I254 (vs. gap), Q256 (≠ S217)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L39 (≠ A12), G40 (≠ A13), K41 (= K14), Y42 (≠ F15), S64 (= S37), G65 (≠ R38), K69 (= K42), Y87 (≠ H56), L106 (= L75), P107 (= P76), N108 (≠ H77), L110 (≠ M79), H111 (= H80), E128 (= E97), K129 (= K98), R157 (≠ M126), A196 (= A170), W199 (vs. gap), R200 (vs. gap), Y217 (= Y183), Y296 (≠ F259)
1evjA Crystal structure of glucose-fructose oxidoreductase (gfor) delta1-22 s64d (see paper)
28% identity, 98% coverage: 7:327/328 of query aligns to 5:323/340 of 1evjA
- active site: K100 (= K98), Y188 (= Y183)
- binding nicotinamide-adenine-dinucleotide: G9 (= G11), L10 (≠ A12), G11 (≠ A13), K12 (= K14), Y13 (≠ F15), D35 (≠ S37), L77 (= L75), P78 (= P76), N79 (≠ H77), H82 (= H80), E99 (= E97), K100 (= K98), R128 (≠ M126), W170 (vs. gap), R171 (vs. gap), Y188 (= Y183), Y267 (≠ F259)
5a06A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with sorbitol (see paper)
29% identity, 98% coverage: 5:327/328 of query aligns to 4:329/336 of 5a06A
- active site: K101 (= K98), Y186 (= Y183)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L11 (≠ A12), G12 (≠ A13), Y13 (≠ K14), Y14 (≠ F15), S36 (= S37), G37 (≠ R38), T38 (≠ D39), K41 (= K42), Y59 (vs. gap), I77 (≠ P74), T78 (≠ L75), P79 (= P76), N80 (≠ H77), L82 (≠ M79), H83 (= H80), E100 (= E97), K101 (= K98), R129 (≠ M126), W168 (≠ I166), R169 (= R167), Y186 (= Y183), Y264 (≠ A256)
- binding sorbitol: D72 (= D69), H96 (= H93), K101 (= K98), R122 (≠ L119), R122 (≠ L119), L124 (≠ C121), F160 (= F155), R169 (= R167), D182 (= D179), Y186 (= Y183), K287 (≠ A285), H296 (≠ A294), E299 (≠ R297), E306 (= E304), G310 (≠ S308), G311 (≠ L309)
Sites not aligning to the query:
5a03C Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
29% identity, 98% coverage: 5:327/328 of query aligns to 4:329/336 of 5a03C
- active site: K101 (= K98), Y186 (= Y183)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G10 (= G11), L11 (≠ A12), G12 (≠ A13), Y13 (≠ K14), Y14 (≠ F15), S36 (= S37), G37 (≠ R38), T38 (≠ D39), K41 (= K42), Y59 (vs. gap), I77 (≠ P74), T78 (≠ L75), P79 (= P76), N80 (≠ H77), L82 (≠ M79), H83 (= H80), E100 (= E97), K101 (= K98), R129 (≠ M126), W168 (≠ I166), R169 (= R167), Y186 (= Y183), Y264 (≠ A256)
- binding beta-D-xylopyranose: K101 (= K98), F160 (= F155), R169 (= R167), D182 (= D179), Y186 (= Y183)
5a05A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with maltotriose (see paper)
29% identity, 98% coverage: 5:327/328 of query aligns to 3:328/335 of 5a05A
- active site: K100 (= K98), Y185 (= Y183)
- binding beta-D-glucopyranose: K100 (= K98), F159 (= F155), D181 (= D179), Y185 (= Y183)
- binding alpha-D-glucopyranose: P259 (≠ A252), S262 (≠ N255)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G11), L10 (≠ A12), G11 (≠ A13), Y12 (≠ K14), Y13 (≠ F15), S35 (= S37), G36 (≠ R38), T37 (≠ D39), K40 (= K42), Y58 (vs. gap), I76 (≠ P74), T77 (≠ L75), P78 (= P76), N79 (≠ H77), L81 (≠ M79), H82 (= H80), E99 (= E97), K100 (= K98), R128 (≠ M126), W167 (≠ I166), R168 (= R167), Y185 (= Y183), Y263 (≠ A256)
5a04A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glucose (see paper)
29% identity, 98% coverage: 5:327/328 of query aligns to 3:328/335 of 5a04A
- active site: K100 (= K98), Y185 (= Y183)
- binding beta-D-glucopyranose: K100 (= K98), F159 (= F155), R168 (= R167), D181 (= D179), Y185 (= Y183)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L10 (≠ A12), G11 (≠ A13), Y12 (≠ K14), Y13 (≠ F15), S35 (= S37), G36 (≠ R38), T37 (≠ D39), K40 (= K42), Y58 (vs. gap), I76 (≠ P74), T77 (≠ L75), P78 (= P76), N79 (≠ H77), L81 (≠ M79), H82 (= H80), E99 (= E97), K100 (= K98), R128 (≠ M126), W167 (≠ I166), R168 (= R167), Y185 (= Y183), Y263 (≠ A256)
5a03E Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
29% identity, 98% coverage: 5:327/328 of query aligns to 3:328/335 of 5a03E
- active site: K100 (= K98), Y185 (= Y183)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G11), L10 (≠ A12), G11 (≠ A13), Y12 (≠ K14), Y13 (≠ F15), S35 (= S37), G36 (≠ R38), T37 (≠ D39), K40 (= K42), Y58 (vs. gap), I76 (≠ P74), T77 (≠ L75), P78 (= P76), N79 (≠ H77), H82 (= H80), E99 (= E97), K100 (= K98), R128 (≠ M126), W167 (≠ I166), R168 (= R167), Y185 (= Y183), Y263 (≠ A256)
- binding beta-D-xylopyranose: K100 (= K98), F159 (= F155), R168 (= R167), D181 (= D179), Y185 (= Y183), E205 (≠ D203), T207 (= T205), R209 (≠ E207)
- binding alpha-D-xylopyranose: H134 (≠ Q132), M268 (vs. gap), R279 (= R281), E280 (≠ F282)
5a02A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glycerol (see paper)
29% identity, 98% coverage: 5:327/328 of query aligns to 3:328/335 of 5a02A
- active site: K100 (= K98), Y185 (= Y183)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L10 (≠ A12), G11 (≠ A13), Y12 (≠ K14), Y13 (≠ F15), S35 (= S37), G36 (≠ R38), T37 (≠ D39), K40 (= K42), Y58 (vs. gap), I76 (≠ P74), T77 (≠ L75), P78 (= P76), L81 (≠ M79), H82 (= H80), E99 (= E97), K100 (= K98), R128 (≠ M126), W167 (≠ I166), R168 (= R167), Y185 (= Y183), Y263 (≠ A256)
2poqX Dimeric dihydrodiol dehydrogenase complexed with inhibitor, isoascorbic acid (see paper)
29% identity, 66% coverage: 5:222/328 of query aligns to 2:219/331 of 2poqX
Sites not aligning to the query:
2o4uX Crystal structure of mammalian dimeric dihydrodiol dehydrogenase (see paper)
29% identity, 66% coverage: 5:222/328 of query aligns to 2:219/331 of 2o4uX
- binding phosphate ion: L2 (= L5), S8 (≠ G11), V9 (≠ A12), A35 (≠ S37), R36 (= R38), R40 (≠ K42), Y57 (= Y59), N101 (≠ T103), A103 (= A105), D145 (≠ R147), R147 (≠ V149), K155 (≠ Y157)
Sites not aligning to the query:
Q7JK39 Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; D-xylose 1-dehydrogenase; D-xylose-NADP dehydrogenase; Dimeric dihydrodiol dehydrogenase; Jmo2DD; EC 1.3.1.20; EC 1.1.1.179 from Macaca fuscata fuscata (Japanese macaque) (see paper)
29% identity, 66% coverage: 5:222/328 of query aligns to 3:220/334 of Q7JK39
- H79 (= H80) mutation to E: Decrease in K(d) and K(m) value for NADPH. Elimination of the fluorescence-energy transfer and enhancement of NADPH fluorescence by the binary complex formation. Potent inhibition of the dehydrogenase activity by high ionic strength.
- Y180 (= Y183) mutation to F: Significant loss of activity. No effect on the high affinity for NADPH, fluorescence-energy transfer and enhancement of NADPH fluorescence by the binary complex formation.
Q9TQS6 Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; Cmo2DD; D-xylose 1-dehydrogenase; D-xylose-NADP dehydrogenase; Dimeric dihydrodiol dehydrogenase; EC 1.3.1.20; EC 1.1.1.179 from Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) (see paper)
29% identity, 66% coverage: 5:222/328 of query aligns to 3:220/334 of Q9TQS6
- R148 (≠ V149) mutation to A: No effect on activity. Reduced activity and exhibits significant temperature sensitivity; when associated with A-202.
- R202 (≠ I204) mutation to A: No effect on activity. Reduced activity and exhibits significant temperature sensitivity; when associated with A-148.
Q2I8V6 1,5-anhydro-D-fructose reductase; Anhydrofructose reductase; 1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming); EC 1.1.1.292 from Ensifer adhaerens (Sinorhizobium morelense) (see paper)
29% identity, 74% coverage: 6:248/328 of query aligns to 3:250/333 of Q2I8V6
- ASTI 9:12 (≠ AAKF 12:15) binding
- S10 (≠ A13) mutation to G: Almost no effect.
- A13 (= A16) mutation to G: Can use NAD as cosubstrate as well as NADP.
- S33 (= S37) mutation to D: No activity.
- ST 33:34 (≠ SR 37:38) binding
- R38 (≠ K42) binding
- TTNELH 71:76 (≠ LPHPMH 75:80) binding
- EK 93:94 (= EK 97:98) binding
- K94 (= K98) mutation to G: Less than 1% remaining activity.
- N120 (≠ A124) binding
- WR 162:163 (≠ NI 165:166) binding
- D176 (= D179) mutation to A: Less than 1% remaining activity.
- H180 (≠ Y183) mutation to A: Less than 2% remaining activity.
- G206 (≠ W206) mutation to I: No effect.
Sites not aligning to the query:
4koaA Crystal structure analysis of 1,5-anhydro-d-fructose reductase from sinorhizobium meliloti (see paper)
32% identity, 60% coverage: 5:202/328 of query aligns to 2:202/333 of 4koaA
- active site: K94 (= K98), H180 (≠ Y183)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G11), A9 (= A12), S10 (≠ A13), T11 (≠ K14), I12 (≠ F15), S33 (≠ A36), S34 (= S37), R38 (≠ K42), T71 (≠ L75), N73 (≠ H77), H76 (= H80), K94 (= K98), Q160 (≠ P163)
2glxA Crystal structure analysis of bacterial 1,5-af reductase (see paper)
29% identity, 74% coverage: 6:248/328 of query aligns to 2:249/332 of 2glxA
- active site: K93 (= K98), H179 (≠ Y183)
- binding acetate ion: K93 (= K98), H179 (≠ Y183)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G11), A8 (= A12), S9 (≠ A13), T10 (≠ K14), I11 (≠ F15), S32 (= S37), T33 (≠ R38), R37 (≠ K42), S69 (≠ P74), T70 (≠ L75), N72 (≠ H77), H75 (= H80), E92 (= E97), K93 (= K98), H121 (≠ M126), W161 (≠ N165), R162 (≠ I166)
Sites not aligning to the query:
3e18A Crystal structure of NAD-binding protein from listeria innocua
28% identity, 48% coverage: 52:210/328 of query aligns to 48:220/348 of 3e18A
- active site: K94 (= K98), H178 (≠ Y183)
- binding nicotinamide-adenine-dinucleotide: A70 (≠ P74), T71 (≠ L75), P72 (= P76), N73 (≠ H77), H76 (= H80), E93 (= E97), K94 (= K98), N122 (≠ H130), W161 (≠ I166), R162 (= R167), H178 (≠ Y183)
Sites not aligning to the query:
6jw6A The crystal structure of kand2 in complex with NAD (see paper)
30% identity, 60% coverage: 4:200/328 of query aligns to 1:197/341 of 6jw6A
- binding nicotinamide-adenine-dinucleotide: G10 (≠ A13), F11 (= F15), M12 (≠ A16), D33 (≠ S37), L34 (≠ R38), T70 (≠ P74), T71 (≠ L75), P72 (= P76), N73 (≠ H77), L75 (≠ M79), H76 (= H80), Q79 (≠ W83), E93 (= E97), K94 (= K98), N122 (≠ M126), W161 (≠ N165), H179 (≠ Y183)
Sites not aligning to the query:
Query Sequence
>3609222 FitnessBrowser__Dino:3609222
MTTPLRWGILGAAKFAREQMGPAIHAARGATLAALASRDAAKAAPFRAFAPGLRVHTDYD
ALLADPEVDAVYIPLPHPMHVPWAMKALEAGKHVLAEKPLAMTAAEIDPLISRRNATGLH
CAEAYMIVHHPQWQRARALLREGAIGRLVHVAGIFTYDNRADPGNIRNAADQGGGGIPDI
GVYTYGCTRWMTEAEPEAITHADITWENGVDTIARVSARFPGFTAHWVNSMRMAPFQDMV
FHGETGVLRLTAPFNAQVFGEARVELHRPGGGGDHTVTVERFPAANQYVAQVEAFGRTVR
EGAEYPWSLEDARGTQAMIDAVYAAAKG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory