SitesBLAST
Comparing 3609244 FitnessBrowser__Dino:3609244 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
Q96PE7 Methylmalonyl-CoA epimerase, mitochondrial; DL-methylmalonyl-CoA racemase; EC 5.1.99.1 from Homo sapiens (Human) (see paper)
64% identity, 99% coverage: 2:133/134 of query aligns to 45:175/176 of Q96PE7
- H50 (= H7) binding
- R104 (≠ E61) to L: in dbSNP:rs6748672
- H122 (= H79) binding
- E172 (= E130) binding
6qh4C Crystal structure of human methylmalonyl-coa epimerase (mcee) p.Arg143cys variant
63% identity, 99% coverage: 1:133/134 of query aligns to 8:137/138 of 6qh4C
3oa4A Crystal structure of hypothetical protein bh1468 from bacillus halodurans c-125
38% identity, 96% coverage: 4:131/134 of query aligns to 4:129/138 of 3oa4A
6wf6A Streptomyces coelicolor methylmalonyl-coa epimerase (see paper)
34% identity, 97% coverage: 2:131/134 of query aligns to 2:135/141 of 6wf6A
6wfhA Streptomyces coelicolor methylmalonyl-coa epimerase substrate complex (see paper)
34% identity, 97% coverage: 2:131/134 of query aligns to 2:135/139 of 6wfhA
- active site: H7 (= H7), E43 (≠ V43), Q60 (≠ E54), H84 (= H79), E134 (= E130)
- binding cobalt (ii) ion: H7 (= H7), Q60 (≠ E54), H84 (= H79), E134 (= E130)
- binding (3S,5R,9R,19E)-1-[(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-4-hydroxy-3-(phosphonooxy)tetrahydrofuran-2-yl]-3,5,9,19-tetrahydroxy-8,8,20-trimethyl-10,14-dioxo-2,4,6-trioxa-18-thia-11,15-diaza-3,5-diphosphahenicos-19-en-21-oic acid 3,5-dioxide (non-preferred name): H7 (= H7), Q39 (≠ H39), Q60 (≠ E54), A70 (≠ P64), K73 (≠ G67), W74 (≠ F68), H83 (= H78), H84 (= H79), L107 (= L102), G114 (= G110), S115 (≠ A111), F122 (= F118), P125 (= P121), K126 (= K122), L132 (= L128), E134 (= E130)
6xbqA Streptomyces coelicolor methylmalonyl-coa epimerase in complex with carboxy-carba(dethia)-coa
34% identity, 97% coverage: 2:131/134 of query aligns to 2:135/144 of 6xbqA
- active site: H7 (= H7), E43 (≠ V43), Q60 (≠ E54), H84 (= H79), E134 (= E130)
- binding carboxymethyldethia coenzyme *a: Q39 (≠ H39), Q60 (≠ E54), A70 (≠ P64), K73 (≠ G67), W74 (≠ F68), H83 (= H78), H84 (= H79), L107 (= L102), F122 (= F118), P125 (= P121), K126 (= K122), L132 (= L128)
- binding cobalt (ii) ion: H7 (= H7), Q60 (≠ E54), H84 (= H79), E134 (= E130)
6wfiA Methylmalonyl-coa epimerase in complex with 2-nitronate-propionyl-coa (see paper)
34% identity, 97% coverage: 2:131/134 of query aligns to 2:135/144 of 6wfiA
- active site: H7 (= H7), E43 (≠ V43), Q60 (≠ E54), H84 (= H79), E134 (= E130)
- binding cobalt (ii) ion: H7 (= H7), Q60 (≠ E54), H84 (= H79), E134 (= E130)
- binding [1-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethylsulfanyl]-1-oxidanylidene-propan-2-ylidene]-bis(oxidanidyl)azanium: H7 (= H7), Q39 (≠ H39), Q60 (≠ E54), A70 (≠ P64), K73 (≠ G67), W74 (≠ F68), H83 (= H78), H84 (= H79), L107 (= L102), G114 (= G110), S115 (≠ A111), I120 (≠ V116), F122 (= F118), P125 (= P121), L132 (= L128), E134 (= E130)
6wf7A Methylmalonyl-coa epimerase in complex with methylmalonyl-coa and nh4+ (see paper)
34% identity, 97% coverage: 2:131/134 of query aligns to 2:135/144 of 6wf7A
- active site: H7 (= H7), E43 (≠ V43), Q60 (≠ E54), H84 (= H79), E134 (= E130)
- binding (S)-Methylmalonyl-Coenzyme A: Q39 (≠ H39), E43 (≠ V43), Q60 (≠ E54), A70 (≠ P64), W74 (≠ F68), H83 (= H78), H84 (= H79), L107 (= L102), G114 (= G110), S115 (≠ A111), F122 (= F118), P125 (= P121), K126 (= K122), L132 (= L128), E134 (= E130)
- binding methylmalonyl-coenzyme a: Q39 (≠ H39), Q60 (≠ E54), A70 (≠ P64), W74 (≠ F68), H83 (= H78), H84 (= H79), L107 (= L102), G114 (= G110), S115 (≠ A111), I120 (≠ V116), F122 (= F118), P125 (= P121), K126 (= K122), L132 (= L128), E134 (= E130)
6xbtA Streptomyces coelicolor methylmalonyl-coa epimerase (q60a) in complex with 2-nitronate-propionyl-coa
34% identity, 97% coverage: 2:131/134 of query aligns to 2:135/140 of 6xbtA
- active site: H7 (= H7), E43 (≠ V43), A60 (≠ E54), H84 (= H79), E134 (= E130)
- binding cobalt (ii) ion: H7 (= H7), H84 (= H79), E134 (= E130)
- binding coenzyme a: Q39 (≠ H39), A70 (≠ P64), K73 (≠ G67), W74 (≠ F68), K77 (= K71), H83 (= H78), L107 (= L102), F122 (= F118), P125 (= P121), K126 (= K122), L132 (= L128)
- binding [1-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethylsulfanyl]-1-oxidanylidene-propan-2-ylidene]-bis(oxidanidyl)azanium: H7 (= H7), Q39 (≠ H39), A70 (≠ P64), K73 (≠ G67), W74 (≠ F68), H83 (= H78), H84 (= H79), L107 (= L102), G114 (= G110), S115 (≠ A111), P125 (= P121), K126 (= K122), L132 (= L128), E134 (= E130)
2qh0A Crystal structure of a glyoxalase from clostridium acetobutylicum
27% identity, 96% coverage: 4:131/134 of query aligns to 3:126/129 of 2qh0A
4mttA Ni- and zn-bound gloa2 at low resolution (see paper)
31% identity, 97% coverage: 4:133/134 of query aligns to 2:125/128 of 4mttA
Query Sequence
>3609244 FitnessBrowser__Dino:3609244
MIGRLNHVAIAVPDLEAASAQYANTLGANVGAPQDEPDHGVTVVFIELPNTKIELLYPLG
ENSPIAGFLEKNPSGGIHHICYEVEDILAARDKLSAAGARVLGTGEPKIGAHGKPVLFLH
PKDFNGTLVELEQV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory