SitesBLAST
Comparing 3609268 FitnessBrowser__Dino:3609268 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4jnqA Crystal structure of a thioredoxin reductase from brucella melitensis
60% identity, 94% coverage: 2:314/332 of query aligns to 1:315/315 of 4jnqA
- active site: C137 (= C137), C140 (= C140), D141 (= D141)
- binding dihydroflavine-adenine dinucleotide: I12 (= I13), G13 (= G14), S14 (= S15), G15 (= G16), P16 (= P17), A17 (= A18), A36 (≠ Q37), G37 (= G38), Q39 (= Q40), G42 (= G43), Q43 (= Q44), L44 (= L45), N52 (= N53), I85 (= I85), A113 (= A113), T114 (= T114), C140 (= C140), G283 (= G282), D284 (= D283), R291 (= R290), Q292 (= Q291), A293 (= A292)
5u63B Crystal structure of putative thioredoxin reductase from haemophilus influenzae
59% identity, 93% coverage: 3:310/332 of query aligns to 5:316/319 of 5u63B
- active site: C139 (= C137), C142 (= C140), D143 (= D141)
- binding flavin-adenine dinucleotide: G16 (= G14), S17 (= S15), G18 (= G16), P19 (= P17), A20 (= A18), T39 (≠ Q37), G40 (= G38), Q42 (= Q40), G45 (= G43), Q46 (= Q44), L47 (= L45), T50 (= T48), N55 (= N53), H87 (= H84), I88 (= I85), A115 (= A113), T116 (= T114), G117 (= G115), H248 (= H245), G288 (= G282), D289 (= D283), R296 (= R290), Q297 (= Q291), A298 (= A292), S301 (= S295)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R121 (≠ K119), G157 (= G155), H179 (= H177), R180 (= R178), R181 (= R179), I246 (= I243), G247 (= G244), H248 (= H245), R296 (= R290)
5vt3B High resolution structure of thioredoxin-disulfide reductase from vibrio vulnificus cmcp6 in complex with NADP and fad
57% identity, 94% coverage: 3:314/332 of query aligns to 4:319/319 of 5vt3B
- active site: C138 (= C137), C141 (= C140), D142 (= D141)
- binding flavin-adenine dinucleotide: G15 (= G14), S16 (= S15), G17 (= G16), P18 (= P17), A19 (= A18), T38 (≠ Q37), G39 (= G38), Q41 (= Q40), G44 (= G43), Q45 (= Q44), L46 (= L45), T49 (= T48), N54 (= N53), H86 (= H84), I87 (= I85), S114 (≠ A113), T115 (= T114), G116 (= G115), E162 (= E161), H247 (= H245), G287 (= G282), D288 (= D283), R295 (= R290), Q296 (= Q291), A297 (= A292), S300 (= S295)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L122 (= L121), G156 (= G155), G157 (= G156), N158 (= N157), T159 (= T158), H178 (= H177), R179 (= R178), R180 (= R179), R184 (= R183), I245 (= I243), G246 (= G244), R295 (= R290), Q296 (= Q291)
P0A9P4 Thioredoxin reductase; TRXR; EC 1.8.1.9 from Escherichia coli (strain K12) (see 2 papers)
59% identity, 92% coverage: 5:310/332 of query aligns to 4:314/321 of P0A9P4
- 36:43 (vs. 37:44, 50% identical) binding
- C136 (= C137) modified: Disulfide link with 139, Redox-active
- C139 (= C140) modified: Disulfide link with 136, Redox-active
- 287:296 (vs. 283:292, 70% identical) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1f6mA Crystal structure of a complex between thioredoxin reductase, thioredoxin, and the NADP+ analog, aadp+ (see paper)
59% identity, 92% coverage: 5:310/332 of query aligns to 3:313/320 of 1f6mA
- active site: S135 (≠ C137), C138 (= C140), D139 (= D141)
- binding 3-aminopyridine-adenine dinucleotide phosphate: L119 (= L121), G153 (= G155), G154 (= G156), N155 (= N157), T156 (= T158), E159 (= E161), H175 (= H177), R176 (= R178), R177 (= R179), R181 (= R183), I243 (= I243), G244 (= G244), H245 (= H245), R293 (= R290), Q294 (= Q291)
- binding flavin-adenine dinucleotide: G12 (= G14), S13 (= S15), G14 (= G16), P15 (= P17), A16 (= A18), T35 (≠ Q37), G36 (= G38), E38 (≠ Q40), G41 (= G43), Q42 (= Q44), L43 (= L45), T46 (= T48), V49 (= V51), N51 (= N53), H83 (= H84), I84 (= I85), A111 (= A113), T112 (= T114), G113 (= G115), H245 (= H245), G285 (= G282), D286 (= D283), R293 (= R290), Q294 (= Q291), A295 (= A292), S298 (= S295)
1tdfA Crystal structure of escherichia coli thioredoxin reductase refined at 2 angstrom resolution: implications for a large conformational change during catalysis (see paper)
59% identity, 92% coverage: 5:310/332 of query aligns to 3:313/316 of 1tdfA
- active site: C135 (= C137), S138 (≠ C140), D139 (= D141)
- binding flavin-adenine dinucleotide: G12 (= G14), S13 (= S15), G14 (= G16), P15 (= P17), A16 (= A18), T35 (≠ Q37), G36 (= G38), E38 (≠ Q40), G41 (= G43), Q42 (= Q44), L43 (= L45), T46 (= T48), V49 (= V51), N51 (= N53), H83 (= H84), I84 (= I85), A111 (= A113), T112 (= T114), S138 (≠ C140), G285 (= G282), D286 (= D283), R293 (= R290), Q294 (= Q291), A295 (= A292), S298 (= S295)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L119 (= L121), I151 (= I153), T156 (= T158), E159 (= E161), H175 (= H177), R176 (= R178), R181 (= R183), E183 (= E185), I243 (= I243), G244 (= G244), H290 (= H287), R293 (= R290)
P9WHH1 Thioredoxin reductase; TR; TRXR; EC 1.8.1.9 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
49% identity, 94% coverage: 10:321/332 of query aligns to 17:326/335 of P9WHH1
- SGPA 22:25 (= SGPA 15:18) binding
- Y32 (= Y25) modified: Phosphotyrosine; by PtkA; mutation to A: Significantly reduces phosphorylation.
- 44:51 (vs. 37:44, 38% identical) binding
- N60 (= N53) binding
- V93 (≠ I85) binding
- C145 (= C137) modified: Disulfide link with 148, Redox-active
- C148 (= C140) modified: Disulfide link with 145, Redox-active
- S166 (≠ T158) binding
- H185 (= H177) binding
- R191 (= R183) binding
- I248 (= I243) binding
- Y268 (= Y263) binding
- D288 (= D283) binding
- R295 (= R290) binding
- RQAV 295:298 (= RQAV 290:293) binding
2a87A Crystal structure of m. Tuberculosis thioredoxin reductase (see paper)
50% identity, 91% coverage: 10:312/332 of query aligns to 8:308/313 of 2a87A
- active site: F39 (≠ P41), L43 (= L45), D48 (= D50), C136 (= C137), C139 (= C140), D140 (= D141)
- binding flavin-adenine dinucleotide: G12 (= G14), S13 (= S15), G14 (= G16), P15 (= P17), A16 (= A18), F34 (≠ V36), E35 (≠ Q37), G36 (= G38), G40 (= G42), G41 (= G43), A42 (≠ Q44), L43 (= L45), T46 (= T48), V49 (= V51), N51 (= N53), D83 (≠ H84), V84 (≠ I85), M113 (≠ T114), C139 (= C140), G278 (= G282), D279 (= D283), R286 (= R290), Q287 (= Q291), A288 (= A292), V289 (= V293)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L120 (= L121), G155 (= G156), D156 (≠ N157), S157 (≠ T158), H176 (= H177), R177 (= R178), R178 (= R179), R182 (= R183), I239 (= I243), Y259 (= Y263), R283 (≠ H287), R286 (= R290)
P29509 Thioredoxin reductase 1; TR; TrxR; Thioredoxin peroxidase 1; TPx; Thioredoxin-dependent peroxide reductase 1; EC 1.8.1.9 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 3 papers)
47% identity, 93% coverage: 7:314/332 of query aligns to 3:319/319 of P29509
- SGPA 11:14 (= SGPA 15:18) binding
- IA 40:41 (≠ IQ 39:40) binding
- Q45 (= Q44) binding
- N54 (= N53) binding
- V87 (≠ I85) binding
- C142 (= C137) modified: Disulfide link with 145, Redox-active
- C145 (= C140) binding ; modified: Disulfide link with 142, Redox-active
- D288 (= D283) binding
- RQA 295:297 (= RQA 290:292) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3d8xA Crystal structure of saccharomyces cerevisiae ndpph dependent thioredoxin reductase 1 (see paper)
47% identity, 93% coverage: 7:314/332 of query aligns to 2:318/318 of 3d8xA
- active site: C141 (= C137), C144 (= C140), D145 (= D141)
- binding flavin-adenine dinucleotide: I8 (= I13), S10 (= S15), G11 (= G16), P12 (= P17), A13 (= A18), Y31 (≠ V36), G33 (= G38), A36 (vs. gap), I39 (= I39), G43 (= G43), Q44 (= Q44), I51 (≠ V51), N53 (= N53), T85 (≠ H84), V86 (≠ I85), T118 (= T114), G119 (= G115), C144 (= C140), G286 (= G282), D287 (= D283), R294 (= R290), Q295 (= Q291), A296 (= A292), S299 (= S295)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: M125 (≠ L121), G160 (= G154), S164 (≠ T158), R184 (= R178), K185 (≠ R179), R189 (= R183), I247 (= I243)
3itjB Crystal structure of saccharomyces cerevisiae thioredoxin reductase 1 (trr1) (see paper)
47% identity, 93% coverage: 7:314/332 of query aligns to 3:319/319 of 3itjB
- active site: C142 (= C137), C145 (= C140), D146 (= D141)
- binding flavin-adenine dinucleotide: I9 (= I13), G10 (= G14), S11 (= S15), G12 (= G16), P13 (= P17), A14 (= A18), Y32 (≠ V36), E33 (≠ Q37), G34 (= G38), A37 (vs. gap), I40 (= I39), A41 (≠ Q40), G44 (= G43), Q45 (= Q44), T49 (= T48), I52 (≠ V51), N54 (= N53), T86 (≠ H84), V87 (≠ I85), T119 (= T114), G120 (= G115), W135 (≠ K130), C145 (= C140), G287 (= G282), D288 (= D283), R295 (= R290), Q296 (= Q291), A297 (= A292), S300 (= S295)
5w4cA Crystal structure of thioredoxin reductase from cryptococcus neoformans in complex with fad (fo conformation)
48% identity, 95% coverage: 3:316/332 of query aligns to 13:336/356 of 5w4cA
- binding calcium ion: E99 (≠ D83), E116 (vs. gap), E118 (vs. gap)
- binding flavin-adenine dinucleotide: I23 (= I13), G24 (= G14), S25 (= S15), P27 (= P17), G28 (≠ A18), Y46 (≠ V36), G48 (= G38), A51 (vs. gap), F54 (vs. gap), G58 (= G43), Q59 (= Q44), L60 (= L45), T63 (= T48), N68 (= N53), V101 (≠ I85), T134 (= T114), G135 (= G115), G302 (= G282), D303 (= D283), R310 (= R290), Q311 (= Q291), A312 (= A292), S315 (= S295)
Sites not aligning to the query:
5uthA Crystal structure of thioredoxin reductase from mycobacterium smegmatis in complex with fad
49% identity, 91% coverage: 10:312/332 of query aligns to 6:305/306 of 5uthA
- active site: C133 (= C137), C136 (= C140), D137 (= D141)
- binding flavin-adenine dinucleotide: I9 (= I13), G10 (= G14), S11 (= S15), G12 (= G16), P13 (= P17), A14 (= A18), F32 (≠ V36), E33 (≠ Q37), G34 (= G38), Q36 (= Q40), G39 (= G43), A40 (≠ Q44), L41 (= L45), N49 (= N53), D81 (≠ H84), V82 (≠ I85), M110 (≠ T114), G111 (= G115), C136 (= C140), G275 (= G282), D276 (= D283), R283 (= R290), Q284 (= Q291), A285 (= A292), A288 (≠ S295)
8ccmA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with compound 2-06
49% identity, 91% coverage: 10:312/332 of query aligns to 5:304/305 of 8ccmA
- binding flavin-adenine dinucleotide: I8 (= I13), G9 (= G14), S10 (= S15), G11 (= G16), P12 (= P17), A13 (= A18), E32 (≠ Q37), G33 (= G38), Q35 (= Q40), G38 (= G43), A39 (≠ Q44), L40 (= L45), T43 (= T48), N48 (= N53), D80 (≠ H84), V81 (≠ I85), M109 (≠ T114), G110 (= G115), T131 (≠ A136), C135 (= C140), G274 (= G282), D275 (= D283), R282 (= R290), Q283 (= Q291), A284 (= A292), A287 (≠ S295)
- binding ~{N}6-(4-aminophenyl)-1,2-benzothiazole-3,6-diamine: R114 (≠ K119), H115 (≠ W120), L116 (= L121), R173 (= R178), E200 (≠ T205), I201 (≠ V206), I235 (= I243)
8cclA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with fragment f2x-entry a09
49% identity, 91% coverage: 10:312/332 of query aligns to 5:304/305 of 8cclA
- binding flavin-adenine dinucleotide: I8 (= I13), G9 (= G14), S10 (= S15), G11 (= G16), P12 (= P17), A13 (= A18), E32 (≠ Q37), G33 (= G38), Q35 (= Q40), G38 (= G43), A39 (≠ Q44), L40 (= L45), T43 (= T48), N48 (= N53), D80 (≠ H84), V81 (≠ I85), M109 (≠ T114), G110 (= G115), T131 (≠ A136), C135 (= C140), G274 (= G282), D275 (= D283), R282 (= R290), Q283 (= Q291), A284 (= A292), A287 (≠ S295)
- binding [1,2]thiazolo[5,4-b]pyridin-3-amine: L116 (= L121), R173 (= R178), E200 (≠ T205), I201 (≠ V206)
8cckA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with fragment f2x-entry h07
49% identity, 91% coverage: 10:312/332 of query aligns to 5:304/305 of 8cckA
- binding flavin-adenine dinucleotide: G9 (= G14), S10 (= S15), G11 (= G16), P12 (= P17), A13 (= A18), E32 (≠ Q37), G33 (= G38), Q35 (= Q40), G38 (= G43), A39 (≠ Q44), L40 (= L45), T43 (= T48), N48 (= N53), D80 (≠ H84), V81 (≠ I85), M109 (≠ T114), G110 (= G115), T131 (≠ A136), C135 (= C140), G274 (= G282), D275 (= D283), R282 (= R290), Q283 (= Q291), A284 (= A292), A287 (≠ S295)
- binding ~{N}-(4-hydroxyphenyl)-2-pyrazol-1-yl-ethanamide: R114 (≠ K119), H115 (≠ W120), L116 (= L121), V148 (≠ I153), R173 (= R178), E200 (≠ T205), I201 (≠ V206)
8ccjA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with NADPH
49% identity, 91% coverage: 10:312/332 of query aligns to 5:304/305 of 8ccjA
- binding flavin-adenine dinucleotide: I8 (= I13), G9 (= G14), S10 (= S15), G11 (= G16), P12 (= P17), A13 (= A18), E32 (≠ Q37), G33 (= G38), Q35 (= Q40), G38 (= G43), A39 (≠ Q44), L40 (= L45), T43 (= T48), N48 (= N53), D80 (≠ H84), V81 (≠ I85), M109 (≠ T114), G110 (= G115), T131 (≠ A136), C135 (= C140), G274 (= G282), D275 (= D283), R282 (= R290), Q283 (= Q291), A284 (= A292), A287 (≠ S295)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G150 (= G155), G151 (= G156), D152 (≠ N157), S153 (≠ T158), E156 (= E161), H172 (= H177), R173 (= R178), R174 (= R179), R178 (= R183), I235 (= I243)
6bpyA Aspergillus fumigatus thioredoxin reductase (see paper)
48% identity, 93% coverage: 7:314/332 of query aligns to 2:323/324 of 6bpyA
- binding flavin-adenine dinucleotide: I8 (= I13), G9 (= G14), S10 (= S15), G11 (= G16), P12 (= P17), A13 (= A18), Y31 (≠ V36), E32 (≠ Q37), G33 (= G38), A36 (vs. gap), T38 (vs. gap), A39 (≠ Q40), G42 (= G43), Q43 (= Q44), L44 (= L45), T47 (= T48), I50 (≠ V51), N52 (= N53), T84 (≠ H84), I85 (= I85), T120 (= T114), G121 (= G115), C146 (= C140), G291 (= G282), D292 (= D283), R299 (= R290), Q300 (= Q291), A301 (= A292), S304 (= S295)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G163 (= G155), G164 (= G156), S166 (≠ T158), R186 (= R178), R187 (= R179), R191 (= R183), V252 (≠ I243)
Q39243 Thioredoxin reductase 1, mitochondrial; NADPH-dependent thioredoxin reductase 1; NTR1; NADPH-dependent thioredoxin reductase B; AtNTRB; EC 1.8.1.9 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
48% identity, 93% coverage: 4:313/332 of query aligns to 47:367/375 of Q39243
- SGPA 58:61 (= SGPA 15:18) binding
- FE 79:80 (≠ VQ 36:37) binding
- IAPGGQ 87:92 (≠ IQPGGQ 39:44) binding
- N101 (= N53) binding
- V134 (≠ I85) binding
- C189 (= C137) modified: Disulfide link with 192, Redox-active
- C192 (= C140) binding ; modified: Disulfide link with 189, Redox-active
- D337 (= D283) binding
- RQA 344:346 (= RQA 290:292) binding
Sites not aligning to the query:
- 1:37 modified: transit peptide, Mitochondrion
2q7vA Crystal structure of deinococcus radiodurans thioredoxin reductase (see paper)
48% identity, 92% coverage: 10:313/332 of query aligns to 10:313/313 of 2q7vA
- active site: P41 (= P41), I45 (≠ L45), E50 (≠ D50), C141 (= C137), C144 (= C140), D145 (= D141)
- binding flavin-adenine dinucleotide: G16 (= G16), P17 (= P17), A18 (= A18), E37 (≠ Q37), K38 (≠ G38), G43 (= G43), Q44 (= Q44), I45 (≠ L45), N53 (= N53), E85 (≠ H84), V86 (≠ I85), T118 (= T114), G119 (= G115), C144 (= C140), G282 (= G282), D283 (= D283), Q291 (= Q291), L292 (≠ A292), S295 (= S295)
Query Sequence
>3609268 FitnessBrowser__Dino:3609268
MSSETRHLKVLIIGSGPAGYTAAVYASRAMLNPVLVQGIQPGGQLTITTDVENWPGDSSV
MGPDLMVRMEEHAKAMGTEIIADHINRLDLSSRPFTAYGDSGTIYKAEALILATGAQAKW
LGLPSEEHFKGFGVSACATCDGFFYRGKEVVVIGGGNTAVEEALFLTNFASKVTLVHRRD
SLRAEKILQDRLFKNPKVEVIWDHTVEEVVGTDTPRGVEGVVIKHRDTGETRTLPCAGFF
VAIGHAPASELVIDQLETHMGGYVVTAPDSTATSIPGVFAAGDLTDHEYRQAVTSAGMGC
MAALEAERFLAEMDGETTADAGVYAAPVNAAE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory