SitesBLAST
Comparing 3609274 FitnessBrowser__Dino:3609274 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1n5wD Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
57% identity, 93% coverage: 4:153/162 of query aligns to 4:153/158 of 1n5wD
- binding flavin-adenine dinucleotide: S43 (= S43), H44 (≠ Q44)
- binding fe2/s2 (inorganic) cluster: C40 (= C40), S43 (= S43), C45 (= C45), G46 (= G46), C48 (= C48), C60 (= C60), C100 (= C100), G101 (= G101), C103 (= C103), C135 (= C135), C137 (= C137)
- binding pterin cytosine dinucleotide: Q99 (= Q99), C137 (= C137)
P19921 Carbon monoxide dehydrogenase small chain; CO dehydrogenase subunit S; CO-DH S; EC 1.2.5.3 from Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5) (Oligotropha carboxidovorans) (see 2 papers)
56% identity, 96% coverage: 4:159/162 of query aligns to 6:161/166 of P19921
- C42 (= C40) binding
- C47 (= C45) binding
- C50 (= C48) binding
- C62 (= C60) binding
- C102 (= C100) binding
- C105 (= C103) binding
- C137 (= C135) binding
- C139 (= C137) binding
1n5wA Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
56% identity, 96% coverage: 4:159/162 of query aligns to 4:159/161 of 1n5wA
- binding flavin-adenine dinucleotide: S43 (= S43), H44 (≠ Q44)
- binding fe2/s2 (inorganic) cluster: I38 (≠ V38), G39 (= G39), C40 (= C40), S43 (= S43), C45 (= C45), G46 (= G46), C48 (= C48), C60 (= C60), C100 (= C100), G101 (= G101), C103 (= C103), C135 (= C135), C137 (= C137)
1ffvA Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava (see paper)
59% identity, 91% coverage: 4:151/162 of query aligns to 4:150/155 of 1ffvA
- binding fe2/s2 (inorganic) cluster: I38 (≠ V38), C40 (= C40), S43 (= S43), C45 (= C45), G46 (= G46), C48 (= C48), C60 (= C60), C99 (= C100), G100 (= G101), C102 (= C103), C134 (= C135), C136 (= C137)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q98 (= Q99), C136 (= C137)
1ffuD Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor (see paper)
59% identity, 91% coverage: 4:151/162 of query aligns to 5:151/156 of 1ffuD
- binding fe2/s2 (inorganic) cluster: C41 (= C40), S44 (= S43), H45 (≠ Q44), C46 (= C45), G47 (= G46), C49 (= C48), C61 (= C60), C100 (= C100), G101 (= G101), C103 (= C103), C135 (= C135), C137 (= C137)
4zohC Crystal structure of glyceraldehyde oxidoreductase (see paper)
58% identity, 92% coverage: 3:151/162 of query aligns to 11:157/161 of 4zohC
- binding fe2/s2 (inorganic) cluster: C47 (= C40), S50 (= S43), C52 (= C45), G53 (= G46), C55 (= C48), C67 (= C60), C106 (= C100), G107 (= G101), C109 (= C103), C141 (= C135), C143 (= C137)
- binding pterin cytosine dinucleotide: Q105 (= Q99), C143 (= C137)
5y6qA Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
50% identity, 93% coverage: 3:153/162 of query aligns to 4:154/157 of 5y6qA
- binding fe2/s2 (inorganic) cluster: G40 (= G39), C41 (= C40), D42 (= D41), G44 (≠ S43), C46 (= C45), G47 (= G46), C49 (= C48), C61 (= C60), C101 (= C100), G102 (= G101), C104 (= C103), C136 (= C135), C138 (= C137)
- binding pterin cytosine dinucleotide: Q100 (= Q99), C138 (= C137)
1sb3C Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
48% identity, 94% coverage: 4:155/162 of query aligns to 5:155/161 of 1sb3C
- binding fe2/s2 (inorganic) cluster: Q39 (≠ V38), C41 (= C40), G44 (≠ S43), C46 (= C45), G47 (= G46), C49 (= C48), C61 (= C60), C100 (= C100), G101 (= G101), C103 (= C103), C135 (= C135), C137 (= C137)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q99), C137 (= C137)
1t3qA Crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 (see paper)
44% identity, 91% coverage: 1:147/162 of query aligns to 3:148/162 of 1t3qA
- binding fe2/s2 (inorganic) cluster: I40 (≠ V38), C42 (= C40), E43 (≠ D41), G45 (≠ S43), C47 (= C45), G48 (= G46), C50 (= C48), R60 (≠ K58), C62 (= C60), C101 (= C100), G102 (= G101), C104 (= C103), C136 (= C135), C138 (= C137)
- binding pterin cytosine dinucleotide: Q100 (= Q99), C138 (= C137)
P77165 Aldehyde oxidoreductase iron-sulfur-binding subunit PaoA; EC 1.2.99.6 from Escherichia coli (strain K12) (see paper)
45% identity, 94% coverage: 1:153/162 of query aligns to 60:226/229 of P77165
- C99 (= C40) binding
- C104 (= C45) binding
- G105 (= G46) binding
- C107 (= C48) binding
- C119 (= C60) binding
- C158 (= C100) binding
- C161 (= C103) binding
- C208 (= C135) binding
- C210 (= C137) binding
5g5gA Escherichia coli periplasmic aldehyde oxidase (see paper)
45% identity, 94% coverage: 1:153/162 of query aligns to 9:175/175 of 5g5gA
- binding fe2/s2 (inorganic) cluster: G47 (= G39), C48 (= C40), D49 (= D41), G51 (≠ S43), C53 (= C45), G54 (= G46), C56 (= C48), C68 (= C60), C107 (= C100), G108 (= G101), C110 (= C103), C157 (= C135), C159 (= C137)
4usaA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with trans-cinnamaldehyde (see paper)
45% identity, 93% coverage: 1:151/162 of query aligns to 1:153/907 of 4usaA
- binding fe2/s2 (inorganic) cluster: V38 (= V38), C40 (= C40), E41 (≠ D41), G43 (≠ S43), C45 (= C45), G46 (= G46), C48 (= C48), R58 (≠ K58), C60 (= C60), C100 (= C100), G101 (= G101), C103 (= C103), C137 (= C135), C139 (= C137)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q99), C139 (= C137)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding bicarbonate ion: 460, 531, 532, 535, 539
- binding hydrocinnamic acid: 255, 425, 494, 497, 535, 626
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4us9A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with 3- phenylpropionaldehyde (see paper)
45% identity, 93% coverage: 1:151/162 of query aligns to 1:153/907 of 4us9A
- binding fe2/s2 (inorganic) cluster: V38 (= V38), C40 (= C40), E41 (≠ D41), G43 (≠ S43), C45 (= C45), G46 (= G46), C48 (= C48), R58 (≠ K58), C60 (= C60), C100 (= C100), G101 (= G101), C103 (= C103), C137 (= C135), C139 (= C137)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q99), C139 (= C137)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding 3-phenylpropanal: 255, 257, 258, 752
- binding bicarbonate ion: 460, 498, 531, 532, 535, 539, 890, 892
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4us8A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with benzaldehyde (see paper)
45% identity, 93% coverage: 1:151/162 of query aligns to 1:153/907 of 4us8A
- binding fe2/s2 (inorganic) cluster: V38 (= V38), C40 (= C40), E41 (≠ D41), G43 (≠ S43), C45 (= C45), G46 (= G46), C48 (= C48), R58 (≠ K58), C60 (= C60), C100 (= C100), G101 (= G101), C103 (= C103), C137 (= C135), C139 (= C137)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q99), C139 (= C137)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding bicarbonate ion: 460, 498, 531, 532, 535, 539
- binding benzaldehyde: 255, 255, 394, 425, 425, 425, 425, 497, 497, 501, 531, 535, 535, 626, 626, 626, 694, 696, 697
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4c7yA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide (see paper)
45% identity, 93% coverage: 1:151/162 of query aligns to 1:153/907 of 4c7yA
- binding fe2/s2 (inorganic) cluster: C40 (= C40), E41 (≠ D41), G43 (≠ S43), C45 (= C45), G46 (= G46), C48 (= C48), R58 (≠ K58), C60 (= C60), C100 (= C100), G101 (= G101), C103 (= C103), C137 (= C135), C139 (= C137)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q99), C139 (= C137)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding bicarbonate ion: 460, 498, 531, 535, 539
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
- binding hydrogen peroxide: 696, 697, 869
3fc4A Ethylene glycol inhibited form of aldehyde oxidoreductase from desulfovibrio gigas (see paper)
45% identity, 93% coverage: 1:151/162 of query aligns to 1:153/907 of 3fc4A
- binding fe2/s2 (inorganic) cluster: V38 (= V38), C40 (= C40), E41 (≠ D41), G43 (≠ S43), C45 (= C45), G46 (= G46), C48 (= C48), R58 (≠ K58), C60 (= C60), C100 (= C100), G101 (= G101), C103 (= C103), C137 (= C135), C139 (= C137)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q99), C139 (= C137)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding 1,2-ethanediol: 535, 622, 696, 697, 869
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 419, 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
3fahA Glycerol inhibited form of aldehyde oxidoreductase from desulfovibrio gigas (see paper)
45% identity, 93% coverage: 1:151/162 of query aligns to 1:153/907 of 3fahA
- binding fe2/s2 (inorganic) cluster: V38 (= V38), C40 (= C40), E41 (≠ D41), G43 (≠ S43), C45 (= C45), G46 (= G46), C48 (= C48), R58 (≠ K58), C60 (= C60), C100 (= C100), G101 (= G101), C103 (= C103), C137 (= C135), C139 (= C137)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q99), C139 (= C137)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding glycerol: 416, 535, 622, 683, 696, 697, 869, 884, 889, 890, 892
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 419, 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
1sijA Crystal structure of the aldehyde dehydrogenase (a.K.A. Aor or mop) of desulfovibrio gigas covalently bound to [aso3]- (see paper)
45% identity, 93% coverage: 1:151/162 of query aligns to 1:153/907 of 1sijA
- binding fe2/s2 (inorganic) cluster: V38 (= V38), C40 (= C40), E41 (≠ D41), G43 (≠ S43), C45 (= C45), G46 (= G46), C48 (= C48), R58 (≠ K58), C60 (= C60), Q99 (= Q99), C100 (= C100), G101 (= G101), C103 (= C103), C137 (= C135), C139 (= C137)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q99), C139 (= C137)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding arsenite: 535, 696, 697, 869
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 653, 654, 655, 656, 695, 696, 698, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
Q46509 Aldehyde oxidoreductase; Molybdenum iron sulfur protein; EC 1.2.99.7 from Megalodesulfovibrio gigas (Desulfovibrio gigas) (see paper)
45% identity, 93% coverage: 1:151/162 of query aligns to 1:153/907 of Q46509
- C40 (= C40) binding
- C45 (= C45) binding
- C48 (= C48) binding
- C60 (= C60) binding
- C100 (= C100) binding
- C103 (= C103) binding
- C137 (= C135) binding
- C139 (= C137) binding
1dgjA Crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 (see paper)
45% identity, 93% coverage: 1:151/162 of query aligns to 1:153/906 of 1dgjA
- binding fe2/s2 (inorganic) cluster: V38 (= V38), G39 (= G39), C40 (= C40), G41 (≠ D41), G43 (≠ S43), Q44 (= Q44), C45 (= C45), G46 (= G46), C48 (= C48), R58 (≠ K58), C60 (= C60), C100 (= C100), G101 (= G101), C103 (= C103), C137 (= C135), C139 (= C137)
- binding pterin cytosine dinucleotide: Q99 (= Q99), C139 (= C137)
Sites not aligning to the query:
- active site: 391, 427, 503, 507, 535, 869, 870
- binding molybdenum (iv)oxide: 424, 535, 698, 869
- binding pterin cytosine dinucleotide: 423, 424, 535, 652, 655, 656, 657, 658, 697, 698, 700, 702, 703, 799, 800, 803, 804, 807, 865, 866, 867, 868, 869
Query Sequence
>3609274 FitnessBrowser__Dino:3609274
MTSVTMTVNGKARSGEVEGRTLLSSFLRDQLHLTGTHVGCDTSQCGACVVHVDGEAVKAC
TVLAADADGAEVTTIEGMANADGSLSAIQAAFQEHHGLQCGFCTPGMVMSAAALLKDNPK
PSEHEIREYLEGNICRCTGYHNIVKAILAASGQQVAPPMAAE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory