Comparing 3609292 FitnessBrowser__Dino:3609292 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
45% identity, 93% coverage: 4:221/234 of query aligns to 3:221/648 of P75831
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
43% identity, 95% coverage: 5:226/234 of query aligns to 3:225/226 of 5xu1B
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
44% identity, 86% coverage: 25:226/234 of query aligns to 21:228/232 of 1f3oA
Sites not aligning to the query:
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
44% identity, 86% coverage: 25:226/234 of query aligns to 21:228/230 of 1l2tA
Sites not aligning to the query:
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
42% identity, 96% coverage: 1:224/234 of query aligns to 1:226/233 of P75957
7mdyC Lolcde nucleotide-bound
43% identity, 94% coverage: 5:224/234 of query aligns to 2:223/226 of 7mdyC
7arlD Lolcde in complex with lipoprotein and adp (see paper)
43% identity, 93% coverage: 5:221/234 of query aligns to 2:220/222 of 7arlD
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
42% identity, 94% coverage: 5:224/234 of query aligns to 4:225/229 of 7v8iD
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
45% identity, 85% coverage: 23:221/234 of query aligns to 17:216/223 of 2pclA
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
40% identity, 91% coverage: 22:233/234 of query aligns to 20:232/615 of 5lilA
Sites not aligning to the query:
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
40% identity, 91% coverage: 22:233/234 of query aligns to 20:232/592 of 5lj7A
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
41% identity, 91% coverage: 22:234/234 of query aligns to 21:234/650 of 5ws4A
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
40% identity, 95% coverage: 5:227/234 of query aligns to 1:226/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
39% identity, 95% coverage: 5:227/234 of query aligns to 2:227/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
39% identity, 95% coverage: 5:227/234 of query aligns to 2:227/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
39% identity, 95% coverage: 5:227/234 of query aligns to 2:227/344 of 3tuiC
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
44% identity, 85% coverage: 25:222/234 of query aligns to 18:216/219 of 8w6iD
Sites not aligning to the query:
P0A9R7 Cell division ATP-binding protein FtsE from Escherichia coli (strain K12) (see paper)
44% identity, 85% coverage: 25:222/234 of query aligns to 18:216/222 of P0A9R7
8g4cB Bceabs atpgs high res tm (see paper)
37% identity, 85% coverage: 23:221/234 of query aligns to 21:221/248 of 8g4cB
Sites not aligning to the query:
7tchB Bceab e169q variant atp-bound conformation (see paper)
36% identity, 85% coverage: 23:221/234 of query aligns to 20:220/245 of 7tchB
Sites not aligning to the query:
>3609292 FitnessBrowser__Dino:3609292
MTDPVLSLTDVSLRLDGNAGPVDILHDISLKVETGETVGLIGPSGSGKSSLLMVLGGLER
ASSGQVLALGHDLTRLDEDALARFRRDHMGVVFQSFHLIPTMTALENVATPLELAGAADA
FERAEAELVAVGLADRVHHYPSQMSGGEQQRVALARAAAPRPALLLADEPTGNLDGSTGE
AIMDLLFGLRDRHGATLVLVTHSRELAARCDRVVRLRDGRIESDSATAPREAAE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory