Comparing 3609305 FitnessBrowser__Dino:3609305 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9SID3 Hydroxyacylglutathione hydrolase 2, mitochondrial; Glyoxalase II; Glx II; EC 3.1.2.6 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
47% identity, 94% coverage: 15:255/256 of query aligns to 82:323/324 of Q9SID3
2q42A Ensemble refinement of the protein crystal structure of glyoxalase ii from arabidopsis thaliana gene at2g31350 (see paper)
47% identity, 94% coverage: 15:255/256 of query aligns to 12:253/254 of 2q42A
8ewoA Crystal structure of putative glyoxylase ii from pseudomonas aeruginosa
43% identity, 94% coverage: 15:255/256 of query aligns to 14:258/259 of 8ewoA
O24496 Hydroxyacylglutathione hydrolase cytoplasmic; Glyoxalase II; Glx II; EC 3.1.2.6 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
39% identity, 94% coverage: 15:255/256 of query aligns to 12:255/258 of O24496
6rz0A Crystal structure of escherichia coli glyoxalase ii
39% identity, 94% coverage: 15:254/256 of query aligns to 12:249/251 of 6rz0A
1qh5B Human glyoxalase ii with s-(n-hydroxy-n-bromophenylcarbamoyl) glutathione (see paper)
35% identity, 94% coverage: 15:255/256 of query aligns to 12:254/260 of 1qh5B
1qh5A Human glyoxalase ii with s-(n-hydroxy-n-bromophenylcarbamoyl) glutathione (see paper)
35% identity, 94% coverage: 15:255/256 of query aligns to 12:254/260 of 1qh5A
1qh3A Human glyoxalase ii with cacodylate and acetate ions present in the active site (see paper)
35% identity, 94% coverage: 15:255/256 of query aligns to 12:254/260 of 1qh3A
Q16775 Hydroxyacylglutathione hydrolase, mitochondrial; Glyoxalase II; Glx II; EC 3.1.2.6 from Homo sapiens (Human) (see paper)
35% identity, 94% coverage: 15:255/256 of query aligns to 60:302/308 of Q16775
Q8ZRM2 Hydroxyacylglutathione hydrolase; Glyoxalase II; Glx II; EC 3.1.2.6 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
37% identity, 94% coverage: 15:254/256 of query aligns to 12:249/251 of Q8ZRM2
2qedA Crystal structure of salmonella thyphimurium lt2 glyoxalase ii (see paper)
37% identity, 94% coverage: 15:254/256 of query aligns to 13:250/252 of 2qedA
2p18A Crystal structure of the leishmania infantum glyoxalase ii (see paper)
32% identity, 87% coverage: 15:236/256 of query aligns to 24:269/283 of 2p18A
4ysbA Crystal structure of ethe1 from myxococcus xanthus (see paper)
38% identity, 50% coverage: 48:174/256 of query aligns to 48:172/225 of 4ysbA
O95571 Persulfide dioxygenase ETHE1, mitochondrial; Ethylmalonic encephalopathy protein 1; Hepatoma subtracted clone one protein; Sulfur dioxygenase ETHE1; EC 1.13.11.18 from Homo sapiens (Human) (see 4 papers)
31% identity, 63% coverage: 14:174/256 of query aligns to 34:197/254 of O95571
Sites not aligning to the query:
4chlB Human ethylmalonic encephalopathy protein 1 (hethe1) (see paper)
31% identity, 63% coverage: 14:174/256 of query aligns to 18:181/237 of 4chlB
4yslA Crystal structure of sdoa from pseudomonas putida in complex with glutathione (see paper)
32% identity, 64% coverage: 18:181/256 of query aligns to 38:221/294 of 4yslA
Sites not aligning to the query:
4yskA Crystal structure of apo-form sdoa from pseudomonas putida (see paper)
32% identity, 64% coverage: 18:181/256 of query aligns to 38:221/294 of 4yskA
2xf4A Crystal structure of salmonella enterica serovar typhimurium ycbl (see paper)
30% identity, 43% coverage: 33:143/256 of query aligns to 32:160/210 of 2xf4A
Sites not aligning to the query:
4ad9A Crystal structure of human lactb2. (see paper)
33% identity, 55% coverage: 31:172/256 of query aligns to 45:199/288 of 4ad9A
Q53H82 Endoribonuclease LACTB2; Beta-lactamase-like protein 2; EC 3.1.27.- from Homo sapiens (Human) (see paper)
33% identity, 55% coverage: 31:172/256 of query aligns to 45:199/288 of Q53H82
Sites not aligning to the query:
>3609305 FitnessBrowser__Dino:3609305
MALEIYQYPYGPGANYGVLLHDPSSGATASVDAGDAAALRTALKKTGWTLSEIWITHHHA
DHTDGVAEIKAETGCTVIGPKPQSAPIAGVDTRYGDGDRFDFSGHEVRVIHTPGHTIDMI
NFYLPAEGVVFTGDTLFVMGCGRLFEGDGPMMHASLQKLAALPADTVIYCSHEYTEANAD
FALTVDPENPDLKDKAARVKALRAQDKPTVPTTLAEELATNPFLRAHDTRIRAHLGLETA
SDAEVFTEIRRRKDNS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory