Comparing 3609315 FitnessBrowser__Dino:3609315 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
Q51645 (S)-2-haloacid dehalogenase 4A; 2-haloalkanoic acid dehalogenase IVA; Halocarboxylic acid halidohydrolase IVA; L-2-haloacid dehalogenase IVA; EC 3.8.1.2 from Burkholderia cepacia (Pseudomonas cepacia) (see 2 papers)
39% identity, 99% coverage: 3:229/229 of query aligns to 5:227/231 of Q51645
Sites not aligning to the query:
2no5B Crystal structure analysis of a dehalogenase with intermediate complex (see paper)
39% identity, 99% coverage: 3:228/229 of query aligns to 5:226/226 of 2no5B
Q53464 (S)-2-haloacid dehalogenase; 2-haloalkanoic acid dehalogenase; Halocarboxylic acid halidohydrolase; L-2-haloacid dehalogenase; L-DEX; EC 3.8.1.2 from Pseudomonas sp. (strain YL) (see 2 papers)
39% identity, 98% coverage: 3:227/229 of query aligns to 4:223/232 of Q53464
1zrmA Crystal structure of the reaction intermediate of l-2-haloacid dehalogenase with 2-chloro-n-butyrate (see paper)
39% identity, 95% coverage: 3:220/229 of query aligns to 2:214/220 of 1zrmA
3umbA Crystal structure of the l-2-haloacid dehalogenase rsc1362
41% identity, 98% coverage: 3:227/229 of query aligns to 3:226/227 of 3umbA
Q60099 (S)-2-haloacid dehalogenase; 2-haloalkanoic acid dehalogenase; Halocarboxylic acid halidohydrolase; L-2-haloacid dehalogenase; EC 3.8.1.2 from Xanthobacter autotrophicus (see 2 papers)
43% identity, 83% coverage: 3:193/229 of query aligns to 2:185/253 of Q60099
2yn4A L-2-chlorobutryic acid bound complex l-haloacid dehalogenase from a rhodobacteraceae family bacterium (see paper)
28% identity, 90% coverage: 7:212/229 of query aligns to 5:203/225 of 2yn4A
8wbtA Crystal structure of cis-epoxysuccinate hydrolases klcesh[l] mutant d48n complexed with l-ta (see paper)
26% identity, 93% coverage: 1:214/229 of query aligns to 1:217/237 of 8wbtA
4ygrA Crystal structure of had phosphatase from thermococcus onnurineus (see paper)
32% identity, 49% coverage: 89:200/229 of query aligns to 75:187/215 of 4ygrA
Sites not aligning to the query:
8wbqB Crystal structure of cis-epoxysuccinate hydrolases rhcesh[l] mutant e212q complexed with l-ta. (see paper)
26% identity, 93% coverage: 1:213/229 of query aligns to 8:222/244 of 8wbqB
>3609315 FitnessBrowser__Dino:3609315
MPITTCIFDAYGTLFDVSAAAREAAAEPGRAAFATRWPQIARDWRLKQLQYTWLRAITGD
HCDFWQVTQDGLDWALEAAGLGDDAELRERLLQLYWELSAYPEVPAMLGALKDQGLNTGI
LSNGAPDMLAGAVDSAGIGALLDDVLSVESVSIFKPARLVYDLVGARFGCSPEQVMFVSS
NGWDAAAAAAYGFRAVWANRAEEPVDRLPAVPDRIVADLRPLPVLVKEL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory