SitesBLAST
Comparing 3609363 FitnessBrowser__Dino:3609363 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8i9iA Glutamyl-tRNA synthetase from escherichia coli bound to glutamate and zinc
38% identity, 79% coverage: 4:349/440 of query aligns to 5:335/468 of 8i9iA
P04805 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Escherichia coli (strain K12) (see 4 papers)
37% identity, 79% coverage: 4:349/440 of query aligns to 5:335/471 of P04805
- C98 (≠ A96) mutation to S: 10-fold decrease in activity. Strong decrease in zinc content.
- C100 (≠ E98) mutation to S: Loss of activity. Strong decrease in zinc content.; mutation to Y: Does not prevent zinc binding. Reduces only 2-fold the binding affinity for tRNA(Glu), but reduces more than 10-fold the affinity for glutamate in the presence of tRNA(Glu).
- C125 (≠ A123) mutation to S: Loss of activity. Strong decrease in zinc content.
- H127 (≠ A125) mutation to Q: 10-fold decrease in activity. Strong decrease in zinc content.
- H129 (≠ S127) mutation to Q: No change in activity or in zinc content.
- H131 (≠ D129) mutation to Q: No change in activity or in zinc content.
- H132 (≠ R135) mutation to Q: No change in activity or in zinc content.
- C138 (≠ G141) mutation to S: No change in activity or in zinc content.
- S239 (= S241) modified: Phosphoserine; mutation to D: Does not aminoacylate tRNA(Glu), not phosphorylated by HipA.
Q8DLI5 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1) (see paper)
43% identity, 68% coverage: 4:301/440 of query aligns to 5:312/485 of Q8DLI5
- R6 (= R5) binding
- Y192 (= Y183) binding
2cfoA Non-discriminating glutamyl-tRNA synthetase from thermosynechococcus elongatus in complex with glu (see paper)
43% identity, 68% coverage: 4:301/440 of query aligns to 4:311/484 of 2cfoA
4g6zA Crystal structure of a glutamyl-tRNA synthetase glurs from burkholderia thailandensis bound to l-glutamate (see paper)
37% identity, 76% coverage: 4:336/440 of query aligns to 5:323/380 of 4g6zA
3al0C Crystal structure of the glutamine transamidosome from thermotoga maritima in the glutamylation state. (see paper)
30% identity, 100% coverage: 1:440/440 of query aligns to 102:552/564 of 3al0C
- active site: S110 (= S9), K335 (= K242)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R106 (= R5), A108 (= A7), P109 (= P8), G118 (= G17), T122 (= T21), E142 (≠ D41), Y276 (= Y183), R294 (= R201), G295 (= G202), D297 (= D204), H298 (= H205), L324 (= L231), I325 (≠ L232), L333 (= L240)
- binding : T144 (= T43), D145 (= D44), R148 (= R47), Y208 (= Y119), P213 (vs. gap), K252 (≠ L159), M255 (≠ I162), I266 (≠ V173), K269 (≠ R176), S270 (≠ G177), Y276 (= Y183), D297 (= D204), H298 (= H205), L299 (≠ V206), S300 (≠ T207), N301 (= N208), K304 (≠ T211), R330 (≠ G237), P332 (≠ A239), G363 (= G270), W364 (≠ S271), R365 (≠ S272), E370 (≠ V277), S387 (≠ G294), K389 (≠ A296), V391 (≠ T298), I392 (≠ K299), K397 (≠ D304), W400 (≠ P307), R407 (≠ H314), E446 (≠ A344), K447 (≠ N345), Q453 (≠ D351), I457 (≠ W355), R509 (= R405), K520 (= K408), Q524 (≠ M412), R527 (= R415), V535 (≠ R423), T536 (≠ G424), G538 (≠ E426), L539 (≠ M427)
4griB Crystal structure of a glutamyl-tRNA synthetase glurs from borrelia burgdorferi bound to glutamic acid and zinc (see paper)
34% identity, 69% coverage: 2:306/440 of query aligns to 2:320/485 of 4griB
- active site: S9 (= S9), K253 (= K242)
- binding glutamic acid: R5 (= R5), A7 (= A7), S9 (= S9), E41 (≠ D41), Y194 (= Y183), R212 (= R201), W216 (≠ H205)
- binding zinc ion: C105 (≠ A96), C107 (≠ E98), Y128 (= Y119), C132 (≠ A123)
8vc5A Crystal structure of glutamyl-tRNA synthetase glurs from pseudomonas aeruginosa (zinc bound)
34% identity, 84% coverage: 1:368/440 of query aligns to 1:376/488 of 8vc5A
6brlA Crystal structure of a glutamate tRNA ligase from elizabethkingia meningosepticum ccug26117 in complex with its amino acid
30% identity, 99% coverage: 4:440/440 of query aligns to 5:491/502 of 6brlA
2cv2A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu) and an enzyme inhibitor, glu-ams (see paper)
35% identity, 77% coverage: 1:340/440 of query aligns to 1:343/468 of 2cv2A
- active site: K246 (= K242)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R5 (= R5), A7 (= A7), S9 (= S9), G17 (= G17), I21 (≠ T21), E41 (≠ D41), Y187 (= Y183), R205 (= R201), A206 (≠ G202), E208 (≠ D204), W209 (≠ H205), L235 (= L231), L236 (= L232)
- binding : S9 (= S9), T43 (= T43), D44 (= D44), R47 (= R47), V145 (= V142), R163 (≠ L159), Y168 (≠ I164), E172 (≠ S168), V177 (= V173), K180 (≠ R176), S181 (≠ G177), Y187 (= Y183), E207 (≠ S203), E208 (≠ D204), W209 (≠ H205), V211 (≠ T207), R237 (≠ T233), K241 (≠ G237), L272 (≠ R268), M273 (≠ L269), G274 (= G270), E282 (= E276), S299 (≠ G294), P303 (≠ T298), V304 (≠ K299), K309 (≠ D304), W312 (≠ P307), R319 (≠ H314)
Sites not aligning to the query:
- binding : 357, 358, 417, 432, 435, 442, 443, 444, 446, 447, 448
2cv1A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu), atp, and an analog of l-glutamate: a quaternary complex
35% identity, 77% coverage: 1:340/440 of query aligns to 1:343/468 of 2cv1A
- active site: K246 (= K242)
- binding adenosine-5'-triphosphate: P8 (= P8), S9 (= S9), G17 (= G17), T18 (≠ N18), I21 (≠ T21), R47 (= R47), A206 (≠ G202), W209 (≠ H205), L235 (= L231), L236 (= L232)
- binding (4s)-4-amino-5-hydroxypentanoic acid: R5 (= R5), A7 (= A7), E41 (≠ D41), Y187 (= Y183), R205 (= R201), W209 (≠ H205)
- binding : S9 (= S9), E41 (≠ D41), T43 (= T43), D44 (= D44), R47 (= R47), V145 (= V142), R163 (≠ L159), V166 (≠ I162), E172 (≠ S168), V177 (= V173), K180 (≠ R176), S181 (≠ G177), Y187 (= Y183), E207 (≠ S203), E208 (≠ D204), W209 (≠ H205), V211 (≠ T207), R237 (≠ T233), K241 (≠ G237), K243 (≠ A239), M273 (≠ L269), G274 (= G270), S276 (= S272), E282 (= E276), S299 (≠ G294), P303 (≠ T298), V304 (≠ K299), K309 (≠ D304), W312 (≠ P307), R319 (≠ H314)
Sites not aligning to the query:
- binding : 357, 358, 417, 427, 432, 435, 442, 443, 444, 446, 447, 448
2cuzA Glutamyl-tRNA synthetase from thermus thermophilus in complex with l-glutamate (see paper)
35% identity, 77% coverage: 1:340/440 of query aligns to 1:343/468 of 2cuzA
1n78A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with tRNA(glu) and glutamol-amp. (see paper)
35% identity, 77% coverage: 1:340/440 of query aligns to 1:343/468 of 1n78A
- active site: K246 (= K242)
- binding glutamol-amp: R5 (= R5), A7 (= A7), P8 (= P8), S9 (= S9), G17 (= G17), T18 (≠ N18), I21 (≠ T21), E41 (≠ D41), Y187 (= Y183), N191 (≠ S187), R205 (= R201), A206 (≠ G202), E208 (≠ D204), W209 (≠ H205), L235 (= L231), L236 (= L232)
- binding : S9 (= S9), T43 (= T43), D44 (= D44), R47 (= R47), V145 (= V142), R163 (≠ L159), V166 (≠ I162), Y168 (≠ I164), E172 (≠ S168), V177 (= V173), K180 (≠ R176), S181 (≠ G177), Y187 (= Y183), E207 (≠ S203), E208 (≠ D204), W209 (≠ H205), L210 (≠ V206), V211 (≠ T207), R237 (≠ T233), K241 (≠ G237), M273 (≠ L269), G274 (= G270), E282 (= E276), R297 (≠ T292), P303 (≠ T298), V304 (≠ K299), K309 (≠ D304), W312 (≠ P307), R319 (≠ H314)
Sites not aligning to the query:
- binding : 357, 358, 417, 427, 432, 435, 442, 443, 444, 446, 447, 448
1j09A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with atp and glu (see paper)
35% identity, 77% coverage: 1:340/440 of query aligns to 1:343/468 of 1j09A
- active site: K246 (= K242)
- binding adenosine-5'-triphosphate: H15 (= H15), E208 (≠ D204), L235 (= L231), L236 (= L232), K243 (≠ A239), I244 (≠ L240), S245 (= S241), K246 (= K242), R247 (= R243)
- binding glutamic acid: R5 (= R5), A7 (= A7), S9 (= S9), E41 (≠ D41), Y187 (= Y183), N191 (≠ S187), R205 (= R201), W209 (≠ H205)
P27000 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
35% identity, 77% coverage: 1:340/440 of query aligns to 1:343/468 of P27000
Sites not aligning to the query:
- 358 R→Q: Reduces affinity for tRNA and abolishes the ability to discriminate between tRNA(Glu) and tRNA(Gln).
1g59A Glutamyl-tRNA synthetase complexed with tRNA(glu). (see paper)
35% identity, 77% coverage: 1:340/440 of query aligns to 1:343/468 of 1g59A
- binding : D44 (= D44), R45 (≠ P45), A46 (≠ E46), R47 (= R47), P109 (= P100), V145 (= V142), R163 (≠ L159), V166 (≠ I162), E172 (≠ S168), V177 (= V173), K180 (≠ R176), S181 (≠ G177), D182 (= D178), E207 (≠ S203), E208 (≠ D204), R237 (≠ T233), K241 (≠ G237), T242 (≠ E238), K243 (≠ A239), M273 (≠ L269), G274 (= G270), E282 (= E276), S299 (≠ G294), L300 (≠ A295), P303 (≠ T298), V304 (≠ K299), K309 (≠ D304), W312 (≠ P307), R319 (≠ H314)
Sites not aligning to the query:
- binding : 357, 358, 417, 426, 427, 432, 435, 442, 443, 444, 445, 446, 447, 448
4a91A Crystal structure of the glutamyl-queuosine trnaasp synthetase from e. Coli complexed with l-glutamate (see paper)
33% identity, 65% coverage: 5:291/440 of query aligns to 7:277/290 of 4a91A
- active site: S11 (= S9), K229 (= K242)
- binding glutamic acid: R7 (= R5), A9 (= A7), S11 (= S9), E43 (≠ D41), Y170 (= Y183), R188 (= R201), L192 (≠ H205)
- binding zinc ion: C99 (≠ A96), C101 (≠ E98), Y113 (= Y119), C117 (≠ A123)
P27305 Glutamyl-Q tRNA(Asp) synthetase; Glu-Q-RSs; EC 6.1.1.- from Escherichia coli (strain K12) (see paper)
35% identity, 56% coverage: 5:249/440 of query aligns to 19:248/308 of P27305
- E55 (≠ D41) binding
- Y182 (= Y183) binding
- R200 (= R201) binding
3aiiA Archaeal non-discriminating glutamyl-tRNA synthetase from methanothermobacter thermautotrophicus (see paper)
33% identity, 61% coverage: 2:270/440 of query aligns to 11:278/455 of 3aiiA
5zdkA Crystal structure analysis of ttqrs in complex with atp (see paper)
33% identity, 45% coverage: 3:198/440 of query aligns to 26:219/543 of 5zdkA
Sites not aligning to the query:
Query Sequence
>3609363 FitnessBrowser__Dino:3609363
MTTTRFAPSPTGYLHVGNLRTALFNYMIARKAGGTFILRIDDTDPERSKPEYVDAIQEDL
TWLGLTWDRIEYQSRRLDRYAEAADALRAAGRFYEAFETPTELDLKRKKQLNMGRPPVYD
RAALALSEDEKAALRAERGQGVWRFKLDHERITWTDGILGDISIDAASVSDPVLIRGDGQ
VLYTIASVVDDTEMGVTHVVRGSDHVTNTATQIQIMAALGHGHPEFAHHSLLTGPQGEAL
SKRLGTLALRDLRAEGIEPMALLSLMARLGSSQPVEVAGSLEALIEGFDLSTFGAAPTKF
DRADLFPLTARLLHATPFAEVADEIAALGVPAAQAELFWEVARANITTRADLAGWWQLFR
DGGAPLVAEEDRAFVADAFARLPEPPYGPETWGAWTAEVKAASGRKGKGLFMPLRKAVTG
LERGPEMADVMRLLQKKPTL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory