Comparing 3609458 FitnessBrowser__Dino:3609458 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
7x0rB Crystal structure of substrate binding protein lbp complexed wtih guanosine from clostridium thermocellum (see paper)
37% identity, 88% coverage: 27:317/329 of query aligns to 8:294/313 of 7x0rB
Sites not aligning to the query:
6ya3A Crystal structure of pnra from s. Pneumoniae in complex with guanosine (see paper)
35% identity, 90% coverage: 23:317/329 of query aligns to 19:328/331 of 6ya3A
6ya4A Crystal structure of pnra from s. Pneumoniae in complex with cytidine (see paper)
35% identity, 90% coverage: 23:317/329 of query aligns to 20:329/332 of 6ya4A
6y9uA Crystal structure of pnra from s. Pneumoniae in complex with adenosine (see paper)
35% identity, 90% coverage: 23:317/329 of query aligns to 20:329/332 of 6y9uA
6yagA Crystal structure of pnra from s. Pneumoniae in complex with thymidine (see paper)
35% identity, 90% coverage: 23:317/329 of query aligns to 18:327/329 of 6yagA
6yabAAA Lipoprotein (see paper)
35% identity, 90% coverage: 23:317/329 of query aligns to 17:326/329 of 6yabAAA
2fqyA Pnra from treponema pallidum complexed with adenosine. (see paper)
34% identity, 88% coverage: 27:317/329 of query aligns to 7:307/316 of 2fqyA
2fqxA Pnra from treponema pallidum complexed with guanosine (see paper)
34% identity, 88% coverage: 27:317/329 of query aligns to 7:307/316 of 2fqxA
2fqwA Pnra from treponema pallidum as purified from e. Coli (bound to inosine) (see paper)
34% identity, 88% coverage: 27:317/329 of query aligns to 7:307/316 of 2fqwA
P29724 Membrane lipoprotein TmpC; Membrane protein C; 35 kDa antigen; Lipoprotein TpN35; Purine nucleoside receptor A; PnrA from Treponema pallidum (strain Nichols) (see 2 papers)
34% identity, 88% coverage: 27:317/329 of query aligns to 44:344/353 of P29724
Sites not aligning to the query:
4pevA Crystal structure of abc transporter system solute-binding proteins from aeropyrum pernix k1
34% identity, 73% coverage: 27:265/329 of query aligns to 6:260/370 of 4pevA
6shuA Borrelia burgdorferi bmpd nucleoside binding protein bound to adenosine (see paper)
33% identity, 64% coverage: 78:289/329 of query aligns to 57:275/316 of 6shuA
Sites not aligning to the query:
6piiA The evolving story of atzt, a periplasmic binding protein (see paper)
27% identity, 76% coverage: 67:315/329 of query aligns to 52:293/336 of 6piiA
Sites not aligning to the query:
6pi6A The evolving story of atzt, a periplasmic binding protein (see paper)
27% identity, 76% coverage: 67:315/329 of query aligns to 49:290/333 of 6pi6A
Sites not aligning to the query:
6piiC The evolving story of atzt, a periplasmic binding protein (see paper)
27% identity, 76% coverage: 67:315/329 of query aligns to 49:290/331 of 6piiC
Sites not aligning to the query:
3s99A Crystal structure of a basic membrane lipoprotein from brucella melitensis, iodide soak
28% identity, 76% coverage: 67:315/329 of query aligns to 48:288/330 of 3s99A
Sites not aligning to the query:
Q56328 ABC transporter riboflavin-binding protein RfuA; Membrane lipoprotein TpN38(b) from Treponema pallidum (strain Nichols) (see paper)
26% identity, 68% coverage: 28:250/329 of query aligns to 34:269/343 of Q56328
4iilA Crystal structure of rfua (tp0298) of t. Pallidum bound to riboflavin (see paper)
26% identity, 68% coverage: 28:250/329 of query aligns to 7:242/314 of 4iilA
>3609458 FitnessBrowser__Dino:3609458
MTILQKLLGATGALALSTGAALAEPALIFDLGGKFDKSFNEAAFNGAQRWVQETGGTYRE
IELTSEAQREQALRRFAEAGNNPIVMTGFAFGNVLGEVAPDYPDTSFAIIDMVVDQPNVR
SVVFNEHEGSYLVGMMAAMASETGTVGFIGGMDIPLIRKFACGYAQGVKAANPDATVIQN
MTGTTPAAWNDPVKGGELTRAQISQGADVVYAAAGGTGVGVLQTAADEDILSIGVDSNQN
YLHPGEVLTSMMKRVDNAVFAAMSDGPGFETGIRVLGLAEDGVGYALDEFNAELVTDEMQ
AAVEEAKAKIIAGEITVHDYMSDNTCPVM
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory