Comparing 3609459 Dshi_2843 ABC transporter related (RefSeq) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
37% identity, 88% coverage: 26:506/548 of query aligns to 5:476/501 of P04983
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
33% identity, 40% coverage: 24:240/548 of query aligns to 1:215/241 of 4u00A
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
34% identity, 39% coverage: 26:239/548 of query aligns to 2:219/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
33% identity, 39% coverage: 26:239/548 of query aligns to 3:220/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
33% identity, 39% coverage: 26:239/548 of query aligns to 3:220/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
33% identity, 39% coverage: 26:239/548 of query aligns to 3:220/344 of 3tuiC
3c4jA Abc protein artp in complex with atp-gamma-s
32% identity, 41% coverage: 26:247/548 of query aligns to 4:224/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
32% identity, 41% coverage: 26:247/548 of query aligns to 4:224/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
32% identity, 41% coverage: 26:247/548 of query aligns to 4:224/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
32% identity, 41% coverage: 26:247/548 of query aligns to 4:224/242 of 2oljA
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
32% identity, 42% coverage: 26:255/548 of query aligns to 4:241/615 of 5lilA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
29% identity, 42% coverage: 26:253/548 of query aligns to 2:223/240 of 4ymuJ
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
32% identity, 42% coverage: 26:255/548 of query aligns to 4:241/592 of 5lj7A
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
34% identity, 36% coverage: 24:219/548 of query aligns to 3:202/648 of P75831
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
35% identity, 36% coverage: 26:220/548 of query aligns to 4:202/226 of 5xu1B
4hluC Structure of the ecfa-a' heterodimer bound to adp (see paper)
36% identity, 39% coverage: 26:237/548 of query aligns to 5:208/249 of 4hluC
4zirB Crystal structure of ecfaa' heterodimer bound to amppnp (see paper)
35% identity, 39% coverage: 26:237/548 of query aligns to 4:204/247 of 4zirB
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
32% identity, 35% coverage: 26:219/548 of query aligns to 4:197/230 of 6z4wA
A0A0H2ZM82 Cell division ATP-binding protein FtsE from Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) (see paper)
32% identity, 35% coverage: 26:219/548 of query aligns to 4:197/230 of A0A0H2ZM82
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
32% identity, 35% coverage: 26:219/548 of query aligns to 4:197/229 of 6z67B
>3609459 Dshi_2843 ABC transporter related (RefSeq)
MRAGHPPRAGLTNGVGSMSDTQAPAIELRGISKAFGPVQANKDISIRVMPGTIHGIIGEN
GAGKSTLMSILYGFYKADAGEIFIKGQKTEIPDSQAAIRAGIGMVFQHFKLVENFTVLEN
VVLGAEEGALLRPSLAKARKLLRELSEEYELNVAPDALIEDLSVGHQQRVEILKALYRKA
DILILDEPTGVLTPAEADHLFRILEGLKAEGKTIILITHKLREIMETTDTVSVMRRGEMT
ATVKTADTSPEQLAELMVGRKVLLRVDKTPAQPGAPILTVDDLRVVDDQGVERVKGISLQ
VRAGEVLGIAGVAGNGQSELLEVLGGMRPATGRVTVSGQQIDLTGKHSNGKTRRAQGIAH
VPEDRQAEGLIMDYHAWENVAFGYHDDPAYNRGLLMDNRAVRADAEGKIARFDVRPADCW
LAAKNFSGGNQQKIVLAREIERNPELLLVGQPTRGVDIGAIEFIHQQIIALRDAGKAILL
VSVELEEILSLSDRVAVMFDGRIMGERPAAETNEKELGLLMAGITEPPTDKPLIQVVEEN
LAAAAEHS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory