Comparing 3609490 FitnessBrowser__Dino:3609490 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
5vxcA Crystal structure analysis of human clybl in complex with free coash (see paper)
30% identity, 96% coverage: 7:290/295 of query aligns to 1:299/301 of 5vxcA
Q8N0X4 Citramalyl-CoA lyase, mitochondrial; (3S)-malyl-CoA thioesterase; Beta-methylmalate synthase; Citrate lyase subunit beta-like protein; Citrate lyase beta-like; Malate synthase; EC 4.1.3.25; EC 3.1.2.30; EC 2.3.3.-; EC 2.3.3.9 from Homo sapiens (Human) (see 5 papers)
30% identity, 96% coverage: 7:290/295 of query aligns to 40:338/340 of Q8N0X4
Sites not aligning to the query:
5vxoA Crystal structure analysis of human clybl in complex with propionyl- coa (see paper)
31% identity, 96% coverage: 7:289/295 of query aligns to 1:298/298 of 5vxoA
5ugrA Malyl-coa lyase from methylobacterium extorquens (see paper)
32% identity, 95% coverage: 10:289/295 of query aligns to 11:320/323 of 5ugrA
Q3J5L6 L-malyl-CoA/beta-methylmalyl-CoA lyase; (3S)-malyl-CoA/beta-methylmalyl-CoA lyase; (S)-citramalyl-CoA lyase; EC 4.1.3.24; EC 4.1.3.25 from Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) (Rhodobacter sphaeroides) (see paper)
32% identity, 96% coverage: 9:291/295 of query aligns to 11:318/318 of Q3J5L6
4l9yC Crystal structure of rhodobacter sphaeroides malyl-coa lyase in complex with magnesium, glyoxylate, and propionyl-coa (see paper)
32% identity, 95% coverage: 9:289/295 of query aligns to 10:315/316 of 4l9yC
4l9zA Crystal structure of rhodobacter sphaeroides malyl-coa lyase in complex with magnesium, oxalate, and coa (see paper)
32% identity, 95% coverage: 9:287/295 of query aligns to 9:312/313 of 4l9zA
4l9yA Crystal structure of rhodobacter sphaeroides malyl-coa lyase in complex with magnesium, glyoxylate, and propionyl-coa (see paper)
32% identity, 95% coverage: 9:287/295 of query aligns to 10:313/314 of 4l9yA
Q9RUZ0 Citrate lyase subunit beta-like protein; EC 4.1.-.- from Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
35% identity, 92% coverage: 13:284/295 of query aligns to 9:281/284 of Q9RUZ0
1sgjB Crystal structure of citrate lyase beta subunit
35% identity, 76% coverage: 13:236/295 of query aligns to 6:230/231 of 1sgjB
1sgjA Crystal structure of citrate lyase beta subunit
35% identity, 76% coverage: 13:236/295 of query aligns to 6:230/231 of 1sgjA
4l80C Crystal structure of chloroflexus aurantiacus malyl-coa lyase in complex with magnesium, oxalate, and propionyl-coa (see paper)
30% identity, 92% coverage: 10:281/295 of query aligns to 25:323/347 of 4l80C
S5N020 Malyl-CoA/beta-methylmalyl-CoA/citramalyl-CoA lyase; (3S)-3-carboxy-3-hydroxypropanoyl-CoA glyoxylate-lyase; (3S)-citramalyl-CoA pyruvate-lyase; (S)-citramalyl-CoA lyase; Erythro-beta-methylmalyl-CoA; L-malyl-CoA lyase; EC 4.1.3.24; EC 4.1.3.25 from Chloroflexus aurantiacus (see paper)
30% identity, 92% coverage: 10:281/295 of query aligns to 26:324/348 of S5N020
6as5A Crystal structure of protein cite from mycobacterium tuberculosis in complex with magnesium, acetoacetate and coenzyme a (see paper)
33% identity, 85% coverage: 35:286/295 of query aligns to 27:265/267 of 6as5A
Sites not aligning to the query:
6aq4C Crystal structure of protein cite from mycobacterium tuberculosis in complex with magnesium, pyruvate and citramalyl-coa (see paper)
33% identity, 85% coverage: 35:286/295 of query aligns to 29:267/267 of 6aq4C
6aq4B Crystal structure of protein cite from mycobacterium tuberculosis in complex with magnesium, pyruvate and citramalyl-coa (see paper)
33% identity, 85% coverage: 35:286/295 of query aligns to 29:267/268 of 6aq4B
Sites not aligning to the query:
6arbA Crystal structure of protein cite from mycobacterium tuberculosis in complex with magnesium, pyruvate and coenzyme a (see paper)
33% identity, 85% coverage: 35:286/295 of query aligns to 28:266/268 of 6arbA
Sites not aligning to the query:
1u5vA Structure of cite complexed with triphosphate group of atp form mycobacterium tuberculosis
34% identity, 68% coverage: 37:237/295 of query aligns to 31:222/223 of 1u5vA
3r4iA Crystal structure of a citrate lyase (bxe_b2899) from burkholderia xenovorans lb400 at 2.24 a resolution
29% identity, 76% coverage: 33:256/295 of query aligns to 39:279/321 of 3r4iA
>3609490 FitnessBrowser__Dino:3609490
MDRPVDHRARPYRSVLYIPGSKERALHKAQSLPVDAIIFDLEDAVAVEEKANARHLLART
LAETDYGPRAKIVRINGFDTDWGQADLDVIAAARPEAILLPKVNTAADVETLADRLDARP
ETAETTIWTMMETPLGMLNAAQIAAAPRMAGFVMGTNDLAKELDSRFRPDRLPMLTGLGL
CLLAARAHGLVAVDGVYNAFKDDEGLEAECAQGRDMGFDGKTLIHPAQVAIANAVFAPSD
SELALASRQILAFEQAAARGQGVAVVDGKIVENLHVATARQLLAKAEAIQAIAAE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory