Comparing 3609504 FitnessBrowser__Dino:3609504 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
Q8K4H1 Kynurenine formamidase; KFA; KFase; Arylformamidase; N-formylkynurenine formamidase; FKF; EC 3.5.1.9 from Mus musculus (Mouse) (see paper)
30% identity, 93% coverage: 19:256/257 of query aligns to 43:298/305 of Q8K4H1
4po3X Crystal structure of a c4-c4 sn3 tributyrin phosphonate inhibited by esterase b from lactobacillus rhamnosis
26% identity, 75% coverage: 37:229/257 of query aligns to 39:254/309 of 4po3X
Sites not aligning to the query:
>3609504 FitnessBrowser__Dino:3609504
MDWTAAYDNASFIPGASAYVERWPRAAAAFREGARGEIGIAHGAHPREKLDLFLPEGTPA
GLVVFVHGGYWRRFDRTDWSHLAAGPLARGWAVAMPGYPLCPEVTIPEITASVRGAIALA
ARHVAGPIRLTGHSAGGHLVARMPAAGLAPEVLSRVARIVPISPVSDLEPLLRTEMAETL
RLTPEIAAAESPLHAPAPDCPVTVWVGAEERPVFLDQARWLAEAWGAQHRIAAGRHHFDV
IDDLAEPDGPLTSALLA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory