SitesBLAST
Comparing 3609507 Dshi_2891 short-chain dehydrogenase/reductase SDR (RefSeq) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6b9uA Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from brucella melitensis complexed with nadh
53% identity, 99% coverage: 3:242/242 of query aligns to 2:244/244 of 6b9uA
- active site: G15 (= G16), S142 (= S133), L152 (= L143), Y155 (= Y146), K159 (= K150)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G12), S14 (= S15), G15 (= G16), F16 (= F17), D35 (= D36), R36 (≠ I37), A57 (vs. gap), D58 (= D57), I59 (≠ V58), N85 (= N80), A86 (= A81), V140 (≠ I131), S142 (= S133), Y155 (= Y146), K159 (= K150), A187 (= A178), G188 (= G179), T190 (= T181), P191 (= P182), L192 (= L183), F196 (= F187)
4wecA Crystal structure of a short chain dehydrogenase from mycobacterium smegmatis
43% identity, 99% coverage: 1:239/242 of query aligns to 6:249/258 of 4wecA
- active site: G21 (= G16), S143 (= S133), Q154 (≠ K142), Y157 (= Y146), K161 (= K150)
- binding nicotinamide-adenine-dinucleotide: G17 (= G12), A19 (≠ G14), S20 (= S15), G21 (= G16), I22 (≠ F17), D41 (= D36), I42 (= I37), V61 (= V56), D62 (= D57), V63 (= V58), N89 (= N80), T141 (≠ I131), Y157 (= Y146), K161 (= K150), P187 (= P176), P189 (≠ A178), V190 (≠ G179)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
39% identity, 98% coverage: 2:239/242 of query aligns to 4:241/244 of 4nbuB
- active site: G18 (= G16), N111 (= N105), S139 (= S133), Q149 (≠ L143), Y152 (= Y146), K156 (= K150)
- binding acetoacetyl-coenzyme a: D93 (≠ P87), K98 (≠ E92), S139 (= S133), N146 (≠ R140), V147 (≠ P141), Q149 (≠ L143), Y152 (= Y146), F184 (≠ A178), M189 (≠ L183), K200 (= K198)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G12), N17 (≠ S15), G18 (= G16), I19 (≠ F17), D38 (= D36), F39 (≠ I37), V59 (= V56), D60 (= D57), V61 (= V58), N87 (= N80), A88 (= A81), G89 (= G82), I90 (= I83), T137 (≠ I131), S139 (= S133), Y152 (= Y146), K156 (= K150), P182 (= P176), F184 (≠ A178), T185 (≠ G179), T187 (= T181), M189 (≠ L183)
4bmsF Short chain alcohol dehydrogenase from ralstonia sp. Dsm 6428 in complex with NADPH
36% identity, 98% coverage: 2:239/242 of query aligns to 3:245/249 of 4bmsF
- active site: S137 (= S133), H147 (≠ L143), Y150 (= Y146), K154 (= K150), Q195 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G12), N15 (≠ G14), S16 (= S15), I18 (≠ F17), R38 (≠ I37), R39 (≠ N38), A59 (≠ V56), D60 (= D57), V61 (= V58), N87 (= N80), S88 (≠ A81), G89 (= G82), V110 (= V104), S137 (= S133), Y150 (= Y146), K154 (= K150), G181 (≠ V177), I183 (≠ G179), T185 (= T181), I187 (≠ L183)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
38% identity, 99% coverage: 1:239/242 of query aligns to 3:251/255 of 5itvA
- active site: G18 (= G16), S141 (= S133), Y154 (= Y146), K158 (= K150)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G12), S17 (= S15), G18 (= G16), I19 (≠ F17), D38 (= D36), I39 (= I37), T61 (≠ V56), I63 (≠ V58), N89 (= N80), G91 (= G82), T139 (≠ I131), S141 (= S133), Y154 (= Y146), K158 (= K150), P184 (= P176), G185 (≠ V177), I186 (≠ A178), I187 (≠ G179)
6ihhA Crystal structure of rasadh f12 from ralstonia.Sp in complex with NADPH and a6o
36% identity, 98% coverage: 2:239/242 of query aligns to 3:245/249 of 6ihhA
- binding (2R,3S)-2-ethyl-2-[(2E)-2-(6-methoxy-3,4-dihydro-2H-naphthalen-1-ylidene)ethyl]-3-oxidanyl-cyclopentan-1-one: S137 (= S133), H147 (≠ L143), Y150 (= Y146), L188 (= L184)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G12), N15 (≠ G14), S16 (= S15), G17 (= G16), I18 (≠ F17), R38 (≠ I37), R39 (≠ N38), D60 (= D57), V61 (= V58), N87 (= N80), S88 (≠ A81), G89 (= G82), V110 (= V104), T135 (≠ I131), S137 (= S133), Y150 (= Y146), K154 (= K150), P180 (= P176), G181 (≠ V177), A182 (= A178), I183 (≠ G179), T185 (= T181), S187 (≠ L183)
Sites not aligning to the query:
3lqfA Crystal structure of the short-chain dehydrogenase galactitol- dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD and erythritol (see paper)
40% identity, 100% coverage: 1:242/242 of query aligns to 7:253/254 of 3lqfA
- active site: G22 (= G16), S144 (= S133), Y159 (= Y146), K163 (= K150)
- binding meso-erythritol: N151 (≠ P139), Y159 (= Y146), Y191 (≠ E180), T197 (≠ S186), M200 (≠ G189)
- binding nicotinamide-adenine-dinucleotide: G18 (= G12), S21 (= S15), G22 (= G16), I23 (≠ F17), D42 (= D36), R43 (≠ I37), D66 (= D57), V67 (= V58), S92 (≠ N80), L142 (≠ I131), S144 (= S133), K163 (= K150), P189 (= P176), V192 (≠ T181), T194 (≠ L183), M196 (≠ A185), T197 (≠ S186)
2wsbA Crystal structure of the short-chain dehydrogenase galactitol-dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD (see paper)
40% identity, 100% coverage: 1:242/242 of query aligns to 7:253/254 of 2wsbA
- active site: G22 (= G16), S144 (= S133), Y159 (= Y146), K163 (= K150)
- binding nicotinamide-adenine-dinucleotide: G18 (= G12), S21 (= S15), G22 (= G16), I23 (≠ F17), D42 (= D36), R43 (≠ I37), D66 (= D57), V67 (= V58), S92 (≠ N80), A93 (= A81), L142 (≠ I131), S144 (= S133), Y159 (= Y146), K163 (= K150), P189 (= P176), V192 (≠ T181), T194 (≠ L183), M196 (≠ A185), T197 (≠ S186)
- binding n-propanol: S144 (= S133), M145 (≠ T134), N151 (≠ P139), N151 (≠ P139), Y159 (= Y146), Y159 (= Y146), Y191 (≠ E180)
2wdzA Crystal structure of the short chain dehydrogenase galactitol-dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD+ and 1,2-pentandiol (see paper)
40% identity, 100% coverage: 1:242/242 of query aligns to 7:253/254 of 2wdzA
- active site: G22 (= G16), S144 (= S133), Y159 (= Y146), K163 (= K150)
- binding (2S)-pentane-1,2-diol: A45 (≠ K39), D49 (≠ E43), R62 (≠ Q55), S146 (≠ A135), Y159 (= Y146)
- binding nicotinamide-adenine-dinucleotide: G18 (= G12), S21 (= S15), G22 (= G16), I23 (≠ F17), D42 (= D36), R43 (≠ I37), A65 (vs. gap), D66 (= D57), V67 (= V58), S92 (≠ N80), A93 (= A81), L142 (≠ I131), S144 (= S133), Y159 (= Y146), K163 (= K150), P189 (= P176), V192 (≠ T181), T194 (≠ L183), M196 (≠ A185), T197 (≠ S186)
C0KTJ6 Galactitol 2-dehydrogenase (L-tagatose-forming); Galactitol dehydrogenase; GDH; GatDH; Galactitol:NAD(+) 5-oxidoreductase; EC 1.1.1.406 from Cereibacter sphaeroides (Rhodobacter sphaeroides) (see paper)
40% identity, 100% coverage: 1:242/242 of query aligns to 7:253/254 of C0KTJ6
Sites not aligning to the query:
Q6WVP7 NADP-dependent (R)-specific alcohol dehydrogenase; (R)-specific ADH; Ketoreductase; KRED; EC 1.1.1.- from Lentilactobacillus kefiri (Lactobacillus kefiri) (see paper)
37% identity, 98% coverage: 2:239/242 of query aligns to 4:248/252 of Q6WVP7
Sites not aligning to the query:
8cxaA Crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from mycobacterium smegmatis with bound NAD
38% identity, 99% coverage: 1:239/242 of query aligns to 1:247/251 of 8cxaA
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), Q15 (≠ S15), G16 (= G16), I17 (≠ F17), D36 (= D36), V63 (= V58), N89 (= N80), A91 (≠ G82), S94 (vs. gap), I142 (= I131), S143 (≠ A132), S144 (= S133), Y157 (= Y146), K161 (= K150), P187 (= P176), H188 (≠ V177), I190 (≠ G179), I194 (≠ L183)
5yssB Crystal structure of aminocaproic acid cyclase in complex with NAD (+) (see paper)
39% identity, 98% coverage: 3:239/242 of query aligns to 2:251/255 of 5yssB
- binding nicotinamide-adenine-dinucleotide: G11 (= G12), T13 (≠ G14), S14 (= S15), G15 (= G16), I16 (≠ F17), G35 (vs. gap), F36 (vs. gap), L60 (≠ V58), N86 (= N80), G88 (= G82), I89 (= I83), A137 (= A132), Y151 (= Y146), K155 (= K150), P181 (= P176), G182 (≠ V177), V184 (≠ G179), T186 (= T181)
7djsD Crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with NAD
40% identity, 98% coverage: 3:239/242 of query aligns to 3:247/251 of 7djsD
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), G16 (= G16), I17 (≠ F17), D36 (= D36), L37 (≠ I37), C61 (≠ V56), D62 (= D57), V63 (= V58), N89 (= N80), A90 (= A81), T140 (≠ I131), S142 (= S133), Y155 (= Y146), K159 (= K150), A186 (≠ V177), V187 (≠ A178)
1ahhA 7 alpha-hydroxysteroid dehydrogenase complexed with NAD+ (see paper)
38% identity, 99% coverage: 1:239/242 of query aligns to 7:249/253 of 1ahhA
- active site: G22 (= G16), S146 (= S133), M156 (≠ L143), Y159 (= Y146), K163 (= K150)
- binding nicotinamide-adenine-dinucleotide: G18 (= G12), A21 (≠ S15), D42 (= D36), I43 (= I37), C67 (≠ V56), D68 (= D57), I69 (≠ V58), N95 (= N80), G97 (= G82), T145 (≠ A132), Y159 (= Y146), K163 (= K150), P189 (= P176), G190 (≠ V177), I192 (≠ G179)
1ahiA 7 alpha-hydroxysteroid dehydrogenase complexed with nadh and 7-oxo glycochenodeoxycholic acid (see paper)
38% identity, 99% coverage: 1:239/242 of query aligns to 7:249/255 of 1ahiA
- active site: G22 (= G16), S146 (= S133), M156 (≠ L143), Y159 (= Y146), K163 (= K150)
- binding glycochenodeoxycholic acid: S146 (= S133), A148 (= A135), N151 (≠ S138), Y159 (= Y146), A196 (≠ L183), V200 (≠ F187)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G18 (= G12), A21 (≠ S15), G22 (= G16), I23 (≠ F17), D42 (= D36), I43 (= I37), D68 (= D57), I69 (≠ V58), N95 (= N80), Y159 (= Y146), K163 (= K150), P189 (= P176), G190 (≠ V177), I192 (≠ G179), T194 (= T181), A196 (≠ L183)
Sites not aligning to the query:
P0AET8 7alpha-hydroxysteroid dehydrogenase; 7alpha-HSDH; NAD-dependent 7alpha-hydroxysteroid dehydrogenase; EC 1.1.1.159 from Escherichia coli (strain K12) (see 2 papers)
38% identity, 99% coverage: 1:239/242 of query aligns to 7:249/255 of P0AET8
- I23 (≠ F17) binding
- DI 42:43 (= DI 36:37) binding
- DI 68:69 (≠ DV 57:58) binding
- N95 (= N80) binding
- G99 (≠ H85) binding
- S146 (= S133) binding ; mutation S->A,H: Reduction of the catalytic efficiency by over 65%. No effect on the affinity for cholate and NAD.
- N151 (≠ S138) binding
- Y159 (= Y146) binding ; binding ; mutation to F: Loss of activity.; mutation to H: Reduction of the catalytic efficiency by 87.7%. No effect on the affinity for cholate and NAD.
- K163 (= K150) binding ; mutation to I: Reduction of the catalytic efficiency by 95%. No effect on the affinity for cholate and NAD.; mutation to R: Reduction of the catalytic efficiency by 35%. No effect on the affinity for cholate and NAD.
- ILT 192:194 (≠ GET 179:181) binding
4ituA Crystal structure of s-2-hydroxypropyl coenzyme m dehydrogenase (s- hpcdh) bound to s-hpc and nadh (see paper)
38% identity, 88% coverage: 28:239/242 of query aligns to 28:249/253 of 4ituA
- active site: N113 (= N105), S141 (= S133), Y154 (= Y146), K158 (= K150)
- binding 2-{[(2S)-2-hydroxypropyl]sulfanyl}ethanesulfonic acid: S141 (= S133), Y154 (= Y146), T186 (≠ V177), R209 (≠ F199), Y213 (≠ I203)
- binding 1,4-dihydronicotinamide adenine dinucleotide: D36 (= D36), L37 (≠ I37), D62 (= D57), V63 (= V58), N89 (= N80), V112 (= V104), F139 (≠ I131), S141 (= S133), Y154 (= Y146), K158 (= K150), P184 (= P176), T186 (≠ V177), V187 (≠ A178), T190 (= T181), M192 (≠ L183)
Sites not aligning to the query:
A7IQH5 2-(S)-hydroxypropyl-CoM dehydrogenase 3; S-HPCDH 3; 2-[(S)-2-hydroxypropylthio]ethanesulfonate dehydrogenase 3; Aliphatic epoxide carboxylation component IV; Epoxide carboxylase component IV; SHPCDH3; EC 1.1.1.269 from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) (see 2 papers)
38% identity, 88% coverage: 28:239/242 of query aligns to 30:251/255 of A7IQH5
- D38 (= D36) binding
- DV 64:65 (= DV 57:58) binding
- N91 (= N80) binding
- S143 (= S133) binding ; mutation to A: Retains very weak activity.
- Y156 (= Y146) binding ; mutation to A: Retains some activity but with more than 2200-fold decrease in catalytic efficiency.; mutation to F: Loss of activity.
- K160 (= K150) binding ; mutation to A: Loss of activity.
- T188 (≠ V177) binding
- VTSTG 189:193 (≠ AGETP 178:182) binding
- R211 (≠ F199) mutation to A: Severely impaired in the oxidation of S-HPC or reduction of 2-KPC but largely unaffected in the oxidation and reduction of aliphatic alcohols and ketones.
- K214 (≠ T202) mutation to A: Severely impaired in the oxidation of S-HPC or reduction of 2-KPC but largely unaffected in the oxidation and reduction of aliphatic alcohols and ketones.
- Y215 (≠ I203) binding
Sites not aligning to the query:
4gh5A Crystal structure of s-2-hydroxypropyl coenzyme m dehydrogenase (s- hpcdh) (see paper)
37% identity, 88% coverage: 28:239/242 of query aligns to 28:244/248 of 4gh5A
- active site: N113 (= N105), S141 (= S133), Y154 (= Y146), K158 (= K150)
- binding nicotinamide-adenine-dinucleotide: D36 (= D36), L37 (≠ I37), A61 (≠ V56), D62 (= D57), V63 (= V58), N89 (= N80), A90 (= A81), V112 (= V104), F139 (≠ I131), S141 (= S133), Y154 (= Y146), K158 (= K150), P184 (= P176), V187 (≠ L183), T190 (≠ S186), G191 (≠ F187), M192 (= M188)
Sites not aligning to the query:
Query Sequence
>3609507 Dshi_2891 short-chain dehydrogenase/reductase SDR (RefSeq)
MRLEGKTAIVTGGGSGFGAGIVRKFAAEGAQVIVADINKGAAEAVAEEYGGTAAQVDVSD
ADSMAALAEAHGAPDILVNNAGITHLPKPMEEVTEEEFDRVLAVNAKSVYLSARVFVPAM
KARGSGAILNIASTAGVSPRPKLNWYNASKGWMITATKAMAVELAPFGIRVNALNPVAGE
TPLLASFMGEDTPEMRAKFLATIPLGRFSQPEDLGNAAAFLCSDEASMITGVAMEVDGGR
CI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory