SitesBLAST
Comparing 3609511 FitnessBrowser__Dino:3609511 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
31% identity, 53% coverage: 3:201/378 of query aligns to 48:241/459 of P9WIT1
Sites not aligning to the query:
- 354 modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
29% identity, 44% coverage: 6:173/378 of query aligns to 53:218/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ I23), G75 (= G25), S76 (≠ G26), G77 (= G27), T78 (= T28), G79 (≠ R29), L80 (≠ P30), A83 (≠ K33), C84 (≠ P34), P137 (= P84), G138 (≠ M85), E139 (≠ D86), A142 (≠ G89), T143 (= T98), G146 (= G101), N147 (≠ V102), S149 (≠ A104), T150 (≠ G105), A152 (≠ V107), G153 (≠ S108), E203 (≠ H158), G204 (= G159), I209 (≠ L164)
Sites not aligning to the query:
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
34% identity, 40% coverage: 24:174/378 of query aligns to 76:222/466 of 6lpxA
- binding flavin-adenine dinucleotide: Q76 (≠ R24), G77 (= G25), G78 (= G26), N79 (≠ G27), T80 (= T28), G81 (≠ R29), M82 (≠ P30), G85 (vs. gap), S86 (vs. gap), L139 (= L91), G140 (= G92), A141 (≠ S93), C145 (≠ P97), G149 (= G101), N150 (≠ V102), A152 (= A104), T153 (≠ G105), G157 (= G109), G207 (= G159), I212 (≠ L164)
Sites not aligning to the query:
- binding 2-oxoglutaric acid: 333, 337, 348, 379, 381, 388, 423
- binding flavin-adenine dinucleotide: 39, 75, 422, 459
- binding zinc ion: 381, 388, 422
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
34% identity, 40% coverage: 24:174/378 of query aligns to 76:222/466 of 6lpuA
- binding flavin-adenine dinucleotide: G77 (= G25), G78 (= G26), N79 (≠ G27), T80 (= T28), G81 (≠ R29), G85 (vs. gap), S86 (vs. gap), L139 (= L91), G140 (= G92), A141 (≠ S93), C145 (≠ P97), H146 (≠ T98), G148 (= G100), G149 (= G101), N150 (≠ V102), A152 (= A104), T153 (≠ G105), A155 (≠ V107), E206 (≠ H158), G207 (= G159), I211 (≠ V163), I212 (≠ L164)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 39, 75, 422, 459
- binding (2s)-2-hydroxypentanedioic acid: 333, 337, 348, 379, 381, 388, 423
- binding zinc ion: 381, 388, 422
6lpqA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) (see paper)
34% identity, 40% coverage: 24:174/378 of query aligns to 76:222/466 of 6lpqA
- binding flavin-adenine dinucleotide: G77 (= G25), G78 (= G26), N79 (≠ G27), T80 (= T28), G81 (≠ R29), G85 (vs. gap), S86 (vs. gap), L139 (= L91), G140 (= G92), A141 (≠ S93), C145 (≠ P97), H146 (≠ T98), G149 (= G101), N150 (≠ V102), A152 (= A104), T153 (≠ G105), A155 (≠ V107), G157 (= G109), E206 (≠ H158), G207 (= G159), I211 (≠ V163), I212 (≠ L164)
- binding d-malate: M82 (≠ P30)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 39, 75, 422, 459
- binding d-malate: 333, 337, 348, 379, 381, 388, 422, 423
- binding zinc ion: 381, 388, 422
6lppA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-2-hydroxyglutarate (d-2-hg) (see paper)
34% identity, 40% coverage: 24:174/378 of query aligns to 76:222/466 of 6lppA
- binding flavin-adenine dinucleotide: G77 (= G25), G78 (= G26), N79 (≠ G27), T80 (= T28), G81 (≠ R29), M82 (≠ P30), G85 (vs. gap), S86 (vs. gap), L139 (= L91), G140 (= G92), A141 (≠ S93), C145 (≠ P97), G149 (= G101), N150 (≠ V102), A152 (= A104), T153 (≠ G105), A155 (≠ V107), G157 (= G109), G207 (= G159), I212 (≠ L164)
Sites not aligning to the query:
- binding (2R)-2-hydroxypentanedioic acid: 333, 337, 348, 379, 381, 388, 390, 423
- binding flavin-adenine dinucleotide: 39, 75, 422, 423
- binding zinc ion: 381, 388, 422
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
34% identity, 40% coverage: 24:174/378 of query aligns to 77:223/467 of 6lpnB
- binding flavin-adenine dinucleotide: G78 (= G25), G79 (= G26), N80 (≠ G27), T81 (= T28), G82 (≠ R29), M83 (≠ P30), G86 (vs. gap), S87 (vs. gap), L140 (= L91), A142 (≠ S93), C146 (≠ P97), H147 (≠ T98), G150 (= G101), N151 (≠ V102), A153 (= A104), T154 (≠ G105), G208 (= G159), I212 (≠ V163), I213 (≠ L164)
Sites not aligning to the query:
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
34% identity, 40% coverage: 24:174/378 of query aligns to 129:275/521 of Q8N465
- G131 (= G26) to V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- I147 (vs. gap) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (≠ L45) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- C172 (≠ T64) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (= P84) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (= A104) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (≠ G130) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (= G132) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
- 109 S → W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- 127 N → K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- 169:521 natural variant: Missing (in D2HGA1; uncertain significance)
- 375 D → Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- 386 binding ; binding ; binding ; R→A: Loss of catalytic activity.
- 390 binding ; binding ; T→A: Significantly reduced catalytic activity.
- 399 V → M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- 400:521 natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
- 401 binding ; binding ; K→A: Loss of catalytic activity.
- 419 R → H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- 426 A → T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- 434 binding ; H→A: Loss of catalytic activity.
- 436 G → V: slight reduction in catalytic activity
- 439 N → D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- 441 binding ; H→A: Loss of catalytic activity.
- 443 binding ; N→A: Significantly reduced catalytic activity.
- 444 V → A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- 446 A → V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- 475 binding ; E→A: Loss of catalytic activity.
- 476 binding ; binding ; binding ; H→A: Loss of catalytic activity.
- 477 G → R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
33% identity, 45% coverage: 4:174/378 of query aligns to 47:216/465 of 3pm9A
- active site: A149 (≠ V107), L159 (≠ A117)
- binding flavin-adenine dinucleotide: P69 (≠ I23), Q70 (≠ R24), G71 (= G25), G72 (= G26), N73 (≠ G27), T74 (= T28), G75 (≠ R29), L76 (≠ P30), G79 (vs. gap), Q80 (vs. gap), L91 (≠ T42), L133 (= L91), G134 (= G92), A135 (≠ S93), C139 (≠ P97), T140 (= T98), G142 (= G100), G143 (= G101), S146 (≠ A104), T147 (≠ G105), A149 (≠ V107), G150 (≠ S108), E200 (≠ H158), G201 (= G159), I205 (≠ V163), I206 (≠ L164)
Sites not aligning to the query:
P39976 D-2-hydroxyglutarate--pyruvate transhydrogenase DLD3; D-2HG--pyruvate transhydrogenase DLD3; (R)-2-hydroxyglutarate--pyruvate transhydrogenase; D-lactate dehydrogenase [cytochrome] 3; D-lactate ferricytochrome C oxidoreductase; D-LCR; EC 1.1.99.40; EC 1.1.2.4 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
28% identity, 44% coverage: 4:168/378 of query aligns to 74:237/496 of P39976
Sites not aligning to the query:
- 17 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
5adzC Ether lipid-generating enzyme agps in complex with inhibitor 1a (see paper)
26% identity, 55% coverage: 40:246/378 of query aligns to 178:391/557 of 5adzC
- binding flavin-adenine dinucleotide: P222 (= P84), D223 (≠ G92), S224 (= S93), S228 (≠ P97), T229 (= T98), G232 (= G101), W233 (≠ V102), S235 (≠ A104), T236 (≠ G105), A238 (≠ V107), S239 (= S108), E288 (≠ H158), G289 (= G159), I294 (≠ L164)
- binding (3S)-3-(2-fluorophenyl)-N-((2-oxo-2,3-dihydro-1H-benzo[d]imidazol-5-yl)methyl)butanamide): D223 (≠ G92)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 16, 154, 155, 156, 157, 158, 159, 160, 515
- binding (3S)-3-(2-fluorophenyl)-N-((2-oxo-2,3-dihydro-1H-benzo[d]imidazol-5-yl)methyl)butanamide): 410, 414, 424, 425, 426, 477, 515, 516
4bc7B Mammalian alkyldihydroxyacetonephosphate synthase: arg419his mutant (see paper)
26% identity, 55% coverage: 40:246/378 of query aligns to 164:377/543 of 4bc7B
- binding flavin-adenine dinucleotide: P208 (= P84), D209 (≠ G92), S210 (= S93), S214 (≠ P97), T215 (= T98), G218 (= G101), S221 (≠ A104), T222 (≠ G105), A224 (≠ V107), S225 (= S108), E274 (≠ H158), G275 (= G159), I280 (≠ L164)
Sites not aligning to the query:
- binding 1-dodecanol: 410, 412
- binding flavin-adenine dinucleotide: 16, 140, 142, 143, 144, 145, 146, 147, 150, 151, 501
4bc9B Mammalian alkyldihydroxyacetonephosphate synthase: wild-type, adduct with cyanoethyl (see paper)
26% identity, 55% coverage: 40:246/378 of query aligns to 164:377/542 of 4bc9B
- binding propanenitrile: D209 (≠ G92)
- binding flavin-adenine dinucleotide: P208 (= P84), D209 (≠ G92), S210 (= S93), S214 (≠ P97), T215 (= T98), G218 (= G101), W219 (≠ V102), S221 (≠ A104), T222 (≠ G105), A224 (≠ V107), S225 (= S108), E274 (≠ H158), G275 (= G159), I280 (≠ L164)
Sites not aligning to the query:
- binding propanenitrile: 462, 501
- binding flavin-adenine dinucleotide: 140, 142, 143, 144, 145, 146, 147, 150, 151, 500
8jdpA Crystal structure of h405a mldhd in complex with d-2-hydroxyisovaleric acid (see paper)
32% identity, 21% coverage: 96:176/378 of query aligns to 135:218/455 of 8jdpA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 369, 413, 450
- binding deaminohydroxyvaline: 319, 414
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
32% identity, 21% coverage: 96:176/378 of query aligns to 135:218/456 of 8jdrA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 324, 370, 414, 451
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: 319, 323, 415
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
32% identity, 21% coverage: 96:176/378 of query aligns to 135:218/456 of 8jdqA
Sites not aligning to the query:
- binding (2R)-2-hydroxy-4-methylpentanoic acid: 319, 323, 370, 415
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 370, 414, 451
8jdoA Crystal structure of h405a mldhd in complex with d-2-hydroxyhexanoic acid (see paper)
32% identity, 21% coverage: 96:176/378 of query aligns to 135:218/456 of 8jdoA
Sites not aligning to the query:
- binding (2R)-2-hydroxyhexanoic acid: 319, 323, 415
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 324, 370, 414, 451
8jdnA Crystal structure of h405a mldhd in complex with d-2-hydroxyvaleric acid (see paper)
32% identity, 21% coverage: 96:176/378 of query aligns to 135:218/456 of 8jdnA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 370, 414, 451
- binding (2R)-2-oxidanylpentanoic acid: 319, 323, 415
8jdgA Crystal structure of h405a mldhd in complex with d-2-hydroxybutanoic acid (see paper)
32% identity, 21% coverage: 96:176/378 of query aligns to 135:218/456 of 8jdgA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 370, 414, 451
- binding (2R)-2-oxidanylbutanoic acid: 319, 415
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
32% identity, 21% coverage: 96:176/378 of query aligns to 135:218/455 of 8jdeA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 322, 413, 414, 450
- binding lactic acid: 318, 369, 376, 414
- binding manganese (ii) ion: 369, 376, 413
Query Sequence
>3609511 FitnessBrowser__Dino:3609511
MQTPGSEAELAEVIAGADAPLRIRGGGTRPIGKPVAGEVLSTAALSGIGLYEPGALTLVA
QAGTPLAEVEAALAAERQRLPFEPMDHRGLLGSAGEPTLGGVVAGNVSGPRRIQAGACRD
SLIGVRFVTGEGAVVKNGGRVMKNVTGYDLVKLMAGSHGTLGVLTEVSFKVLPQTETEAT
LTVTGLDDATAVAALSRALGAPYEVSGAAHLPRGADGPETHVRIEGFETSVIYRTGKLTE
LLGKFGPVRVEADPAASRSTWVAIRDVAAFHGTAGDVWRISVKPCDGPAVGAALGGDVIY
DWGGGLVWAHVAPGRDVRGALAGLPGGFSGHATLIRAAEATRAAQPVFQPEPAPLAAISA
GLRAKFDPKGILNPGLMA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory