SitesBLAST
Comparing 3609547 FitnessBrowser__Dino:3609547 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q63XL8 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Burkholderia pseudomallei (strain K96243) (see paper)
56% identity, 93% coverage: 9:323/340 of query aligns to 9:315/318 of Q63XL8
3dahC 2.3 a crystal structure of ribose-phosphate pyrophosphokinase from burkholderia pseudomallei (see paper)
55% identity, 91% coverage: 9:319/340 of query aligns to 4:299/300 of 3dahC
P0A717 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Escherichia coli (strain K12) (see 4 papers)
51% identity, 93% coverage: 8:324/340 of query aligns to 5:314/315 of P0A717
- D129 (= D137) to A: in mutant PRSA1; alters the binding of divalent cations, especially magnesium. Little alteration in the affinity for ribose 5-phosphate and 27-fold decrease of the affinity for ATP. Absence of inhibition by AMP
- D220 (= D230) mutation to E: 4-fold decrease in the affinity binding for Rib-5-P in the presence of magnesium ions. In the presence of cobalt ions, it shows a 15-fold decrease in the affinity binding for Rib-5-P.; mutation to F: With magnesium or manganese ions, the affinity binding values for ATP and Rib-5-P are comparable to those of the wild-type.
- D221 (= D231) mutation to A: The affinity binding for ATP is comparable to those of the wild-type, apart from a slight decrease in the presence of manganese ions. The affinity binding for Rib-5-P is greatly decreased in the presence of both manganese and cobalt ions but only about 2-fold in the presence of magnesium ions.
- D224 (= D234) mutation to A: With magnesium or manganese ions, the affinity binding values for ATP and Rib-5-P are comparable to those of the wild-type.; mutation to S: With magnesium or manganese ions, the affinity binding values for ATP and Rib-5-P are comparable to those of the wild-type.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
6asvC E. Coli prpp synthetase (see paper)
51% identity, 93% coverage: 8:323/340 of query aligns to 3:311/311 of 6asvC
6nfeB Crystal structure of ribose-phosphate pyrophosphokinase from legionella pneumophila with bound amp, adp, and ribose-5-phosphate
56% identity, 89% coverage: 9:310/340 of query aligns to 5:294/299 of 6nfeB
- binding adenosine-5'-diphosphate: F34 (= F44), D36 (= D46), E38 (= E48), R95 (= R105), Q96 (= Q106), H130 (= H139)
- binding 5-O-phosphono-alpha-D-ribofuranose: H130 (= H139), D214 (= D230), D215 (= D231), I216 (= I232), D218 (= D234), T219 (= T235), A220 (= A236), T222 (= T238)
6nfeA Crystal structure of ribose-phosphate pyrophosphokinase from legionella pneumophila with bound amp, adp, and ribose-5-phosphate
55% identity, 89% coverage: 9:310/340 of query aligns to 5:293/298 of 6nfeA
- binding adenosine-5'-diphosphate: F34 (= F44), D36 (= D46), E38 (= E48), R95 (= R105), Q96 (= Q106), H130 (= H139)
- binding adenosine monophosphate: R98 (= R108), V100 (≠ T110), Y146 (= Y155), R175 (= R187), A178 (≠ E190), K181 (≠ Q193)
- binding 5-O-phosphono-alpha-D-ribofuranose: H130 (= H139), D213 (= D230), D214 (= D231), I215 (= I232), D217 (= D234), T218 (= T235), A219 (= A236), T221 (= T238)
4s2uA Crystal structure of the phosphorybosylpyrophosphate synthetase from e. Coli
51% identity, 92% coverage: 8:319/340 of query aligns to 4:308/308 of 4s2uA
7xmvA E.Coli phosphoribosylpyrophosphate (prpp) synthetase type a(amp/adp) filament bound with adp, amp and r5p (see paper)
50% identity, 93% coverage: 8:324/340 of query aligns to 3:306/307 of 7xmvA
- binding adenosine-5'-diphosphate: F33 (= F44), D35 (= D46), E37 (= E48), R94 (= R105), R97 (= R108), H129 (= H139)
- binding adenosine monophosphate: R97 (= R108), V99 (≠ T110), R100 (≠ K111), E131 (≠ A141), F145 (≠ Y155), S147 (≠ A157), V173 (≠ A186), A177 (≠ E190)
- binding 5-O-phosphono-alpha-D-ribofuranose: D212 (= D230), D213 (= D231), M214 (≠ I232), D216 (= D234), T217 (= T235), G219 (= G237), T220 (= T238)
7xmuA E.Coli phosphoribosylpyrophosphate (prpp) synthetase type a filament bound with adp, pi and r5p (see paper)
50% identity, 93% coverage: 8:324/340 of query aligns to 3:306/307 of 7xmuA
- binding adenosine-5'-diphosphate: F33 (= F44), D35 (= D46), E37 (= E48), R94 (= R105), Q95 (= Q106), R97 (= R108), R97 (= R108), R100 (≠ K111), H129 (= H139), E131 (≠ A141), F145 (≠ Y155), S147 (≠ A157), V173 (≠ A186)
- binding 5-O-phosphono-alpha-D-ribofuranose: D168 (= D181), D212 (= D230), M214 (≠ I232), D216 (= D234), T217 (= T235)
P14193 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PPRibP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Bacillus subtilis (strain 168) (see 4 papers)
50% identity, 93% coverage: 8:323/340 of query aligns to 11:316/317 of P14193
- RQ 102:103 (= RQ 105:106) binding
- K198 (= K204) mutation to A: Strong decrease of the Vmax value compared to that of the wild-type. The affinity binding for ATP and Rib-5-P are slightly altered compared to the wild-type. The cooperativity of ADP binding is reduced.
- R200 (= R206) mutation to A: Strong decrease of the Vmax value compared to that of the wild-type enzyme. The affinity binding for ATP and Rib-5-P are slightly altered compared to the wild-type.
- R202 (≠ Q208) mutation to A: 3-fold decrease in the affinity binding for ATP. Slight decrease of the Vmax value.
- N204 (≠ G210) mutation to A: 4.5-fold decrease in the affinity binding for ATP. Slight decrease of the Vmax value.
- E207 (= E213) mutation to A: 2.5-fold decrease in the affinity binding for ATP. Slight decrease of the Vmax value.
- DTAGT 228:232 (= DTAGT 234:238) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
P60891 Ribose-phosphate pyrophosphokinase 1; PPRibP; Phosphoribosyl pyrophosphate synthase I; PRS-I; EC 2.7.6.1 from Homo sapiens (Human) (see 5 papers)
46% identity, 93% coverage: 8:323/340 of query aligns to 5:313/318 of P60891
- S16 (≠ A19) to P: found in patients with phosphoribosyl pyrophosphate synthetase I deficiency; likely pathogenic; dbSNP:rs869025594
- D52 (= D61) to H: in PRPS1 superactivity; no effect on Km; resistant to inhibition by ADP and GDP; dbSNP:rs137852542
- N114 (= N123) to S: in PRPS1 superactivity; no effect on Km; resistant to inhibition by ADP and GDP; dbSNP:rs137852540
- L129 (= L138) to I: in PRPS1 superactivity; no effect on Km; resistant to inhibition by ADP and GDP; dbSNP:rs137852543
- S132 (≠ A141) mutation to A: Reduces catalytic activity.; mutation to F: No effect on catalytic activity.
- V142 (= V151) to L: found in a patient with an intermediate phenotype between ARTS and PRPS1 superactivity; likely pathogenic; normal PRPP synthetase activity in fibroblasts; loss of activity in erythrocytes; dbSNP:rs398122855
- N144 (= N153) mutation to H: No effect on catalytic activity.
- Y146 (= Y155) mutation to F: No effect on catalytic activity.; mutation to M: Reduces catalytic activity.
- D183 (≠ Q193) to H: in PRPS1 superactivity; no effect on Km; resistant to inhibition by ADP and GDP; dbSNP:rs137852541
- A190 (= A200) to V: in PRPS1 superactivity; no effect on Km; resistant to inhibition by ADP and GDP; dbSNP:rs137852544
- H193 (≠ D203) to Q: in PRPS1 superactivity; no effect on Km; resistant to inhibition by ADP and GDP; dbSNP:rs137852545
- D203 (≠ E213) to H: in a breast cancer sample; somatic mutation
- V219 (= V229) to G: in a breast cancer sample; somatic mutation
- H231 (≠ K241) to D: in a colorectal cancer sample; somatic mutation
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
8dbkB Human prps1 with phosphate, atp, and r5p; hexamer with resolved catalytic loops (see paper)
46% identity, 93% coverage: 8:323/340 of query aligns to 4:312/316 of 8dbkB
- binding adenosine monophosphate: R95 (= R105), Q96 (= Q106), N199 (≠ G210)
- binding adenosine-5'-triphosphate: F34 (= F44), N36 (≠ D46), E38 (= E48)
- binding phosphate ion: S46 (≠ N56), R48 (= R58)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: H129 (= H139), D170 (= D181), G172 (= G183), K193 (= K204), R195 (= R206), D219 (= D230), D220 (= D231), D223 (= D234), T224 (= T235), C225 (≠ A236), G226 (= G237), T227 (= T238)
8dbeA Human prps1 with adp; hexamer (see paper)
46% identity, 93% coverage: 8:323/340 of query aligns to 4:312/316 of 8dbeA
- binding adenosine-5'-diphosphate: F34 (= F44), N36 (≠ D46), E38 (= E48), R95 (= R105), Q96 (= Q106), K98 (≠ R108), K99 (≠ R109), D100 (≠ T110), S102 (≠ A112), R103 (= R113), H129 (= H139), D142 (= D152), Y145 (= Y155), S307 (= S318), V308 (= V319), S309 (= S320), F312 (= F323)
- binding 5-O-phosphono-alpha-D-ribofuranose: H129 (= H139), D170 (= D181), D219 (= D230), D220 (= D231), D223 (= D234), T224 (= T235), G226 (= G237), T227 (= T238)
1dkuA Crystal structures of bacillus subtilis phosphoribosylpyrophosphate synthetase: molecular basis of allosteric inhibition and activation. (see paper)
48% identity, 93% coverage: 8:323/340 of query aligns to 3:295/295 of 1dkuA
1ibsB Phosphoribosyldiphosphate synthetase in complex with cadmium ions (see paper)
49% identity, 93% coverage: 8:323/340 of query aligns to 5:299/299 of 1ibsB
1ibsA Phosphoribosyldiphosphate synthetase in complex with cadmium ions (see paper)
49% identity, 93% coverage: 8:323/340 of query aligns to 3:297/297 of 1ibsA
2hcrA Crystal structure of human phosphoribosyl pyrophosphate synthetase 1 in complex with amp(atp), cadmium and sulfate ion (see paper)
45% identity, 93% coverage: 8:323/340 of query aligns to 3:305/305 of 2hcrA
8dbgA Human prps1 with phosphate and atp; hexamer (see paper)
45% identity, 93% coverage: 8:323/340 of query aligns to 4:305/309 of 8dbgA
- binding adenosine-5'-triphosphate: F34 (= F44), N36 (≠ D46), E38 (= E48), R95 (= R105), Q96 (= Q106), K98 (≠ R108), H129 (= H139)
- binding phosphate ion: S46 (≠ N56), R48 (= R58), D216 (= D234), T217 (= T235), C218 (≠ A236), T220 (= T238)
7yk1A Structural basis of human prps2 filaments (see paper)
44% identity, 93% coverage: 9:323/340 of query aligns to 5:303/306 of 7yk1A
- binding adenosine-5'-diphosphate: F34 (= F44), N36 (≠ D46), E38 (= E48), S46 (≠ N56), R48 (= R58), R95 (= R105), K99 (≠ R109), D100 (≠ T110), K101 (= K111), S102 (≠ A112), R103 (= R113), H129 (= H139), D142 (= D152), S298 (= S318), S300 (= S320), F303 (= F323)
- binding phosphate ion: D214 (= D234), C216 (≠ A236), T218 (= T238)
5t3oA Crystal structure of the phosphorybosylpyrophosphate synthetase ii from thermus thermophilus (see paper)
46% identity, 93% coverage: 9:323/340 of query aligns to 4:306/307 of 5t3oA
Query Sequence
>3609547 FitnessBrowser__Dino:3609547
MPAQISPKIISGNANQELAHAISRRMSAYRGMTVGLVDARVERFNDGEIFVEVFENVRGE
DMFIIQSTSNPANDNLMELLIMCDALRRSSAARITAIIPYFGYARQDRRTKARTPITAKL
VANMMVEAGIERVLTMDLHAAQIQGFFDIPVDNLYAAPIFALDVMHNFAGRLDNVTVVSP
DVGGVARARELAQRIGCGLAIVDKRRSQPGVVEEMTVIGEVEGQTCIIVDDICDTAGTLC
KAADLLISEGASEVHSYITHGVLSGPAVERITKSNMKSLVITDSIGATDAVKAAPNIRIV
PTAPVFAQAILNIWNGTSVSSLFDTDTLHPIYEGMYANAS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory