Comparing 3609562 FitnessBrowser__Dino:3609562 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4r5zA Crystal structure of rv3772 encoded aminotransferase (see paper)
41% identity, 75% coverage: 30:300/361 of query aligns to 25:299/353 of 4r5zA
4r2nA Crystal structure of rv3772 in complex with its substrate (see paper)
41% identity, 75% coverage: 30:300/361 of query aligns to 25:299/353 of 4r2nA
Sites not aligning to the query:
8bj3A Crystal structure of medicago truncatula histidinol-phosphate aminotransferase (hisn6) in complex with histidinol-phosphate (see paper)
31% identity, 91% coverage: 27:354/361 of query aligns to 32:357/360 of 8bj3A
Sites not aligning to the query:
4r8dA Crystal structure of rv1600 encoded aminotransferase in complex with plp-mes from mycobacterium tuberculosis
33% identity, 90% coverage: 30:354/361 of query aligns to 30:359/369 of 4r8dA
4wbtA Crystal structure of histidinol-phosphate aminotransferase from sinorhizobium meliloti in complex with pyridoxal-5'-phosphate
31% identity, 87% coverage: 31:344/361 of query aligns to 35:353/369 of 4wbtA
3cq6A Histidinol-phosphate aminotransferase from corynebacterium glutamicum holo-form (plp covalently bound ) (see paper)
31% identity, 91% coverage: 26:354/361 of query aligns to 24:357/364 of 3cq6A
Sites not aligning to the query:
3cq5B Histidinol-phosphate aminotransferase from corynebacterium glutamicum in complex with pmp (see paper)
31% identity, 91% coverage: 26:354/361 of query aligns to 26:359/366 of 3cq5B
1fg7A Crystal structure of l-histidinol phosphate aminotransferase with pyridoxal-5'-phosphate (see paper)
28% identity, 90% coverage: 30:355/361 of query aligns to 30:351/354 of 1fg7A
1fg3A Crystal structure of l-histidinol phosphate aminotransferase complexed with l-histidinol (see paper)
28% identity, 90% coverage: 30:355/361 of query aligns to 30:351/354 of 1fg3A
Sites not aligning to the query:
1geyA Crystal structure of histidinol-phosphate aminotransferase complexed with n-(5'-phosphopyridoxyl)-l-glutamate (see paper)
28% identity, 90% coverage: 30:353/361 of query aligns to 16:335/335 of 1geyA
3ly1D Crystal structure of putative histidinol-phosphate aminotransferase (yp_050345.1) from erwinia carotovora atroseptica scri1043 at 1.80 a resolution
25% identity, 95% coverage: 17:360/361 of query aligns to 6:352/354 of 3ly1D
7szpA Crystal structure of histidinol-phosphate aminotransferase from klebsiella pneumoniae subsp. Pneumoniae (strain hs11286)
29% identity, 90% coverage: 30:355/361 of query aligns to 30:351/353 of 7szpA
Q9X0D0 Histidinol-phosphate aminotransferase; Imidazole acetol-phosphate transaminase; EC 2.6.1.9 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
29% identity, 90% coverage: 32:357/361 of query aligns to 24:335/335 of Q9X0D0
2f8jA Crystal structure of histidinol-phosphate aminotransferase (ec 2.6.1.9) (imidazole acetol-phosphate transferase) (tm1040) from thermotoga maritima at 2.40 a resolution
29% identity, 90% coverage: 32:356/361 of query aligns to 25:335/335 of 2f8jA
1uu0A Histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) (see paper)
29% identity, 90% coverage: 32:356/361 of query aligns to 18:328/328 of 1uu0A
1uu1A Complex of histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) (see paper)
29% identity, 90% coverage: 32:356/361 of query aligns to 19:329/329 of 1uu1A
1h1cA Histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (see paper)
29% identity, 90% coverage: 32:356/361 of query aligns to 19:329/329 of 1h1cA
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
29% identity, 77% coverage: 25:301/361 of query aligns to 23:320/388 of 1gdeA
Sites not aligning to the query:
1gd9A Crystall structure of pyrococcus protein-a1 (see paper)
29% identity, 77% coverage: 25:301/361 of query aligns to 23:320/388 of 1gd9A
1v2fA Crystal structure of t.Th hb8 glutamine aminotransferase complex with 3-phenylpropionate (see paper)
31% identity, 70% coverage: 37:290/361 of query aligns to 37:299/368 of 1v2fA
Sites not aligning to the query:
>3609562 FitnessBrowser__Dino:3609562
MTQITPQPGIMDIALYEGGASKVDGLDTVIKLSSNENPLGPSPAAIAAYKAAAGELHRYP
STDHAGLRGAIAEVYGLDPERIICGAGSDEIIAFLCQAYVGPGDEVIHTEHGFAMYRIST
LAAGGTPVEVPERERVTDVDAILAGVTDRTRLVFIANPNNPTGTMIGGNALARLADGLPE
GCLLVLDGAYAEYVPDYDAGKALVESRENVVMTRTFSKIYGLGALRVGWGYGPRHVIDVL
NRVRGPFNLSTGALAAAEAAVRDRAYTETCRAENAKWRGWLASELAALGIPSDTSSANFV
LARFASPEEAGACDDFLKARGIIVRRVSGYKLPAALRMTVGDAEGCRALVDAVAAFKAQA
A
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory